(data stored in ACNUC30630 zone)

EMBL: CP001737.PE440

CP001737.PE440       Location/Qualifiers
FT   CDS_pept        497804..498319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0459"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce7618 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76878"
FT                   /db_xref="UniProtKB/TrEMBL:C8X709"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76878.1"
FT                   /translation="MIGDGLVVALALQTQGAADLAGGCAQALRQRGWDGDEELADQLGA
FT                   LLGTGPTPLLRPLPVDLEELAGVLEGDPTFGGGRVDRLTGQVWPQAAIDYARETGEEDE
FT                   DGSDDAERWLWVHCEGSRAGYHDMVQFIGTIDDTGRADRLGIAIEGRGAFRRFKDVLAR
FT                   WPGELDRW"
     ttgatcggtg acggtctggt cgttgccctt gccctgcaga cccagggtgc ggccgatctg        60
     gccggtggct gcgcgcaggc attgaggcag cgtggctggg acggcgacga ggagctggct       120
     gatcagcttg gtgccctgct cggaaccggc ccgacgccgc tgctgcggcc gttgccggtg       180
     gatctggagg agctggccgg agtgctcgag ggcgacccga cgttcggtgg cggccgggtg       240
     gatcggctga cgggtcaggt gtggccgcag gcggcgatcg actacgcccg ggagaccggc       300
     gaagaggacg aggacgggtc cgacgacgct gaacggtggc tgtgggtgca ttgcgagggt       360
     tcccgcgccg ggtatcacga catggtgcag ttcatcggca cgatcgacga caccggccgc       420
     gccgatcggt tgggcatcgc gatcgaaggt cgtggggcgt tccgccggtt caaggacgtg       480
     ctggcccgtt ggccgggcga actcgacagg tggtaa                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page