(data stored in ACNUC30630 zone)

EMBL: CP001737.PE445

CP001737.PE445       Location/Qualifiers
FT   CDS_pept        505454..508588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0464"
FT                   /product="helicase domain protein"
FT                   /note="PFAM: helicase domain protein; SNF2-related protein;
FT                   SMART: helicase domain protein; DEAD-like helicase; KEGG:
FT                   bps:BPSL0763 putative helicase SNF2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76883"
FT                   /db_xref="GOA:C8X714"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:C8X714"
FT                   /inference="protein motif:PFAM:PF00271"
FT                   /protein_id="ACV76883.1"
FT                   /translation="MTTTTDVKNELASGRVVQVRGLRWVISDVVPFSSAGSGGRPTSTL
FT                   VELQSVEDDRFNEALSVIWEVEPDARVLPTSSLPDPNEGFDQPQRLAAFLDAVRWGAVA
FT                   SADVNALQAPFRSGVRVEDYQLEPVARALTAPRVNLLLADDVGLGKTIEAGLVAVELLL
FT                   RQRARRIMVICPAGLTVKWRQEMAEKFGREFTVVNSEQCAVLRRTHGSAANPFRVYPLT
FT                   IVSLPWLRSPRGQRLLDEVLPVEGPADTREFDLLILDEAHHVAPAAPKQRYAVDSQQTK
FT                   LIRRLAPHFEHRLFLTATPHNGYPESFEALLELVDNQRFARGVPPDRQAQREVVIRRLK
FT                   TEILEPDGSKRFRQRRTEPLPVQYPEDERQGHALLTEFAAARGIRLKTNRRGRRAADLV
FT                   TLLFKKRLFSSPAAFGRTVAVYRENQLAGSPSASSDAEPAWMDDFLGDIADLDDEDMAD
FT                   EEDDAVRRATVLQGGPSDTELELLERLRLWAEAHTPNPDAKASELLTYLRAVCHPDRDW
FT                   TNERVVVFTEYRDTQDWLVRLLQQDGLGAGVRVLHGGMNPVERENLRQAFQADPTEDPV
FT                   RILIATDAASEGIDLHWQCHRLINYDIPFNPNKLEQRIGRIDRYGQRFDPEVFHFVGTG
FT                   FGRAVDTYEADLEFLARVAEKVARMEEDLGAVNAVLADAVQRRMLGQHVDLDHAVEEPR
FT                   RTRKGRVASDADIAGQVQRLHDQLTDSVAALNLNPQSLKRVVDTALALSHQQSLTRAND
FT                   PDPVWDVPALTGTWEITTRDLPHPLRPDQRRPVTFDPEIAARRREDVVFAHLGHPLVTR
FT                   ATRLLRAAVTSTDIDLHRVAAVLSDDPGLEDTLAVSYARFLVVGGDGARLHEEVLHAGG
FT                   WVRPDGRFARVESFARLDAQLTAALAQGRSAPRQWTNRLAAGWSATQRGLFLALERRAA
FT                   NRRTTVGNLLDRRSQAEEDRITTNLDSFAKSLRQRLSEADDEGTEVGLFARHLADPNEA
FT                   AQFRRDRQSWEERLDRLPAERDAEISRIAARYAQPADHLFPVAVIFVVPTRLVTR"
     atgacgacga cgaccgacgt caagaacgag ctcgcttcgg gacgtgtggt ccaggtgcgg        60
     ggcctgcggt gggtgatcag cgacgttgtg ccgttctcgt ccgccggcag cggtggccgc       120
     cccacgtcga ccctggtgga gctgcagtcc gtcgaggacg accggttcaa cgaggcgctc       180
     tcggtgatct gggaggtcga accggacgcc cgggtgctgc cgaccagctc tctccccgac       240
     ccgaacgagg gattcgacca gccgcagcgg ctggccgcgt tcttggacgc tgtccgctgg       300
     ggcgcagtgg ccagcgccga cgtcaacgcg ctgcaggccc cgttccggtc gggggtccgg       360
     gtggaggact accaattgga gccggtggcc cgggcgctca ccgcccccag ggtgaacctg       420
     ctgctggccg atgacgtcgg cctcggcaag acgatcgagg cgggcctggt cgccgtcgag       480
     ctgctgctgc ggcaacgggc caggcgcatc atggtgatct gcccggccgg cctgaccgtc       540
     aaatggcgtc aggagatggc cgagaagttc ggccgtgagt tcaccgtggt caactcggag       600
     cagtgtgcgg tcctccgacg cacccacggc tcggcggcca acccgttccg ggtctacccg       660
     ttgacgatcg tctctcttcc gtggctgcgg tcgccgcgcg gacagcggtt gctcgacgag       720
     gtgctgccgg tcgagggtcc ggcggacacc cgcgagttcg acctgctgat cctcgacgag       780
     gcccatcacg tcgcgccggc cgcaccgaag cagcggtacg cggtcgactc ccagcagacc       840
     aagctgatcc gtcggctggc accccacttc gaacaccggc tgttcctgac ggcgaccccg       900
     cacaacggct acccagagtc gttcgaggct ctgctggagc tggtggacaa ccagcggttc       960
     gcccgtggcg tgcccccgga ccggcaggcg cagcgggagg tcgtgatccg ccgcctgaag      1020
     acggagattc tcgagcccga cggttccaaa cggttccggc aacgccggac cgagccgctc      1080
     ccagtgcagt acccggagga cgagcggcag ggtcacgcgc tgctcaccga gttcgcggcg      1140
     gcccggggca tccggctgaa gaccaaccgg cgcggccggc gggcggccga cctggtcacc      1200
     ctgctgttca agaagcggct gttctcctcc ccggcggcct tcggccgcac cgtcgccgtg      1260
     taccgggaga accaactcgc cggatcaccg tccgccagca gcgatgccga gcccgcctgg      1320
     atggacgact tcctcggcga catcgccgat ctcgacgacg aggacatggc cgacgaggag      1380
     gacgacgccg tccgccgggc caccgtcctg cagggcggac catctgacac cgaactggag      1440
     ctgctcgaac ggttgcgact ctgggctgag gcgcacacgc cgaacccgga cgcaaaggcc      1500
     agcgagctgc tcacgtacct gcgagcggtg tgccacccgg accgggactg gacgaacgag      1560
     cgcgtcgtcg tcttcaccga gtaccgggac acccaggact ggttggtccg cctgctccag      1620
     caggacgggc tcggcgccgg cgtgcgcgtc ctgcacggcg gcatgaaccc cgtcgagcgg      1680
     gagaacctgc gccaggcgtt ccaggcggat cccaccgagg acccggtgcg catcctgatc      1740
     gccacggacg cggcgagcga gggcatcgac ctgcactggc agtgccaccg gctgatcaac      1800
     tatgacatcc cgttcaaccc gaacaagctg gaacagcgca tcggacgcat cgaccggtac      1860
     gggcagaggt tcgaccccga ggtcttccac ttcgtcggca ccgggttcgg ccgggcggtc      1920
     gacacctacg aggccgacct ggagttcctg gcccgggtcg ctgagaaggt cgcccgcatg      1980
     gaggaggacc tgggcgcagt gaacgcggtt ctggccgacg ccgtccagcg ccggatgctc      2040
     ggccagcacg tcgacttgga ccacgcggtc gaggaaccgc gccgcacccg gaagggacgc      2100
     gtcgcgtccg acgccgacat cgccggccag gtgcagcgac tgcacgacca gctgaccgac      2160
     agcgtcgcgg cgctcaacct gaacccgcag tcgttgaaac gggtcgtcga caccgccctc      2220
     gcactgtccc accagcaatc gctgacccgc gcgaacgacc cggacccggt gtgggacgtg      2280
     cccgcgctga ccggcacctg ggagatcacc acccgcgacc taccccatcc gctgcgaccc      2340
     gaccagcgcc gacccgtcac cttcgacccc gagatcgccg cccgacggcg cgaggacgtc      2400
     gtgttcgccc acctcggcca cccgctggtc acccgggcca cccgattgtt gcgcgccgcc      2460
     gtcaccagca ccgacatcga cctgcaccgg gttgccgcgg tgctcagcga cgaccccggc      2520
     ctggaggaca ccctggccgt ttcctacgcc cgcttcctcg tggtcggcgg cgacggcgcc      2580
     cggctgcacg aggaggtgct gcacgccggc ggctgggtcc ggcctgacgg ccggttcgcc      2640
     cgggtggaga gcttcgcccg gctcgacgcc cagctcaccg ccgcgctcgc gcaggggcgc      2700
     tccgcccctc gccagtggac caaccggctc gccgccgggt ggtccgccac ccaacgggga      2760
     ctgttcctgg ctctcgaacg gcgcgccgcc aaccggcgaa ccaccgtcgg caacctgctg      2820
     gaccggcgta gccaggccga ggaggaccgc atcaccacca acctggacag cttcgccaag      2880
     tccctgcgtc agcgactctc cgaggccgac gacgagggga ccgaggtcgg gctgttcgcc      2940
     cgtcatctcg ccgacccgaa cgaggccgcc cagttccgac gcgatcggca gtcctgggag      3000
     gagcggctgg accggctgcc cgccgaacga gacgccgaga tcagccggat cgccgcccgt      3060
     tacgcgcagc cggccgacca cctgttcccg gtcgcggtca tcttcgtcgt gcccacccgg      3120
     ctggtgaccc gatga                                                       3135
//

If you have problems or comments...

PBIL Back to PBIL home page