(data stored in ACNUC30630 zone)

EMBL: CP001737.PE450

CP001737.PE450       Location/Qualifiers
FT   CDS_pept        518969..520798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0469"
FT                   /product="protein of unknown function DUF262"
FT                   /note="PFAM: protein of unknown function DUF262; protein of
FT                   unknown function DUF1524 RloF; KEGG: maq:Maqu_1316 protein
FT                   of unknown function DUF1524 RloF"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76888"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:C8X719"
FT                   /inference="protein motif:PFAM:PF03235"
FT                   /protein_id="ACV76888.1"
FT                   /translation="MQANTYELKKILMPERRYVIPTFQRDYEWTEEGQWRLLFDDLTVV
FT                   TERLSDAREQALAAGKPVAKADASVTPHFLGAVVCDQLPSAAGGLDVRAVIDGQQRLTT
FT                   LQLLVRGVLDVLIELDSKRVHQVRNLIENPEWMIHEDHDRHKLWPRRKDRDVWPIAMAD
FT                   TAPTGGDHLYLKARRFFANSTRTLADDGGDTVNALVDALLDLFKLVVIDLEDNDDAQVI
FT                   FEVLNGRQTPLTAADLVKNLLFLRGEFADEQELEKLYDLYWSQFDEDWWKQTVGVGHAA
FT                   RGRRDVLLSSWLTAVTGDEANVGHLYKEVRSYLDRTERSTTDVLRELHRYALAYRAITG
FT                   HGDPVPPALARPYRRIDDLRIQTAVPVLLWLRTIPEAELPAPDHERAVLAMESWIFRRL
FT                   VVGANTRGYAKFFVTVLRQGRSAHERGEPIAEAIIATLAAGSGQTAWPSDADIQTSFAN
FT                   NRYYGWFSQERLRFILGTIDDRLRQENPHAEPGDFDYQRLQIEHLLPQRWQDHWAVEAK
FT                   GPAEIELAQQRRGAYVDRIGNLTLVTGSFNASLSNSSWETKRKAIADQSVLQLNRPISS
FT                   IDGWTEAQIDSRASELAEIVCRVWPKTNETPTS"
     atgcaggcga acacgtacga actgaagaag atcctgatgc cggagcgtcg atacgtgatt        60
     cccaccttcc agcgggacta cgagtggacc gaggaaggac agtggcgtct gctgttcgac       120
     gatctcaccg tcgtgaccga gcggctgtcc gacgcccggg agcaggcgtt ggcggccggg       180
     aagcccgtcg ccaaggccga tgcctcggtt actccccact tcctgggtgc cgtggtctgt       240
     gatcaactgc cgtccgccgc cggcggactc gacgttcgcg cggtgatcga tggtcagcaa       300
     cgactgacca ctctgcagct gctcgtccga ggcgtgctgg acgtcctgat cgaactcgac       360
     tcgaagcggg tgcaccaggt ccgcaacctg atcgagaacc cggagtggat gatccacgag       420
     gatcacgatc gccacaaact ctggccgcga cggaaggatc gggacgtgtg gccgatcgcc       480
     atggccgaca ccgcgcccac cggcggtgac cacctgtatc tcaaggcgcg gcgcttcttc       540
     gccaacagca cacgaacgct cgcggacgac ggtggtgaca ctgtcaatgc gctggtcgac       600
     gccttgttgg acctgttcaa gttggtggtc atcgacctgg aggacaacga cgacgcccag       660
     gtgatcttcg aggtgttgaa cggtcggcag actccactga ccgctgccga tctcgtgaag       720
     aatctgctct tcctgcgggg cgagttcgcc gacgagcagg aactcgagaa gctctacgac       780
     ctgtactggt cccaattcga cgaggactgg tggaaacaga ccgtcggtgt cggccatgca       840
     gcgcgtggca ggcgggatgt ccttctctcg tcctggctca ccgcggtcac cggcgacgag       900
     gcgaacgtcg gccacctcta caaggaggtc cgcagctacc tcgaccgcac cgaacggtcg       960
     accaccgacg tgctgcgaga gctgcaccgg tacgcgttgg cctatcgggc gatcaccgga      1020
     cacggagatc ccgtgcctcc cgccctggcc cggccgtacc ggcggatcga cgatctgagg      1080
     atccagaccg cggtaccggt cctgctgtgg ctccggacca tcccggaagc cgagctgccc      1140
     gcacccgacc acgagcgggc ggtgttggcg atggagtcat ggatcttccg acgcctggtg      1200
     gtcggcgcga acacgcgggg ctacgcgaag ttcttcgtga cggtgttgcg acaggggaga      1260
     tccgcccacg agcgtggaga gccgatcgcg gaggccatca tcgcgacctt ggcggcggga      1320
     tcagggcaga cggcctggcc gtccgacgcg gacattcaga cctcattcgc caacaaccgg      1380
     tactacggct ggttctcgca ggagcgcctc aggttcatcc tcgggacgat cgacgatcgc      1440
     ctgaggcagg agaaccccca tgcggagccg ggcgacttcg actaccagcg cctgcagatc      1500
     gaacacctgc tcccgcagcg ttggcaggac cactgggccg tggaagcgaa ggggccggcc      1560
     gagatcgaac tcgcgcagca gcggagggga gcctacgtcg accggatcgg gaacctgacc      1620
     ctggtcactg ggtcgttcaa cgcctcgctg tccaacagtt cgtgggaaac caagcggaag      1680
     gcgatcgccg accagtccgt ccttcagctg aaccggccga tctcctcgat cgacggatgg      1740
     accgaggctc agatcgattc ccgggcatcg gaactggcgg agatcgtttg ccgggtctgg      1800
     ccgaagacga atgaaacccc gacttcgtga                                       1830
//

If you have problems or comments...

PBIL Back to PBIL home page