(data stored in ACNUC30630 zone)

EMBL: CP001737.PE457

CP001737.PE457       Location/Qualifiers
FT   CDS_pept        525801..526916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0476"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: bja:bll4526
FT                   site-specific integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76895"
FT                   /db_xref="GOA:C8X726"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C8X726"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACV76895.1"
FT                   /translation="MSGRNAVGEGSVYQRKDGRWVAAAYVPVADGTYRRVSHYVRTKAD
FT                   AKAKLREMNDRAAKNMPAPPPSLTVEAYLGEWLTHMKQHVRRSTWVAYESNARLHIVPR
FT                   IGRKKLSQLSVRDVRLMIDGLRKDGKGKRTVQYVHATLRAALEHAYREELVTRNVAKMV
FT                   RVERPTPTPKEPLSVAEARRLLTATRDDEDHALWVVMLLLGLRRSEVCGLRWDNVDLEN
FT                   RTLSVTHSVQRVDGKLRELPTKTRRSTRTVPLPAMVHQALVTHRAAMMPTSQYLPEPVY
FT                   VFGTKIGTPMEPRNLTRRWVTLAERQGIRRVPLHALRHSCVSLLLAQGVHPRTVMEIVG
FT                   HSAIEMTMNVYGHVNLETQRRALDELDRTLR"
     atgagcggtc ggaatgccgt cggtgagggc agcgtctacc aacgcaagga cggccgctgg        60
     gtcgctgccg cctacgtccc ggtcgccgac ggcacctacc ggcgcgtctc gcactacgtc       120
     aggaccaagg ccgacgccaa ggccaagctc cgtgagatga atgaccgggc cgcgaagaac       180
     atgccggcgc caccgccgtc gctgaccgtc gaggcctacc tcggcgagtg gctcacgcac       240
     atgaagcagc acgtccggcg cagcacgtgg gtggcctacg agtccaacgc tcggctgcat       300
     atcgtgccgc ggatcggccg caagaagctg tcgcagctat cggtccgcga cgtccggctg       360
     atgatcgacg gcctgcgcaa ggacggtaag ggcaaacgga ccgtccaata cgtgcacgcc       420
     acccttcgcg cggctctgga gcacgcctac cgcgaggaac tcgtcactcg gaacgtcgcc       480
     aagatggtcc gcgtcgagcg gccgaccccg acgccgaagg agccgctcag cgtcgcggag       540
     gcgcgcaggc tgctcaccgc gacgcgcgac gacgaggacc acgcgctctg ggtcgtcatg       600
     ctgctcctcg gcctgcgccg aagcgaggtg tgcggcctca ggtgggacaa cgtcgacctg       660
     gagaaccgga ccctcagcgt cacccacagc gtgcagcggg tcgatggcaa actccgcgag       720
     ctgccgacca agaccaggcg ctcaaccagg acggtgccgc tgccggccat ggtccaccag       780
     gcgctggtca cccaccgggc cgcaatgatg ccgaccagcc agtacctccc cgagccggtc       840
     tacgtgttcg gcaccaagat cggcacgccg atggagccgc gaaacctgac ccggcgctgg       900
     gtcaccttgg ccgagcggca ggggatccgc cgagtgcctc tccacgcgct caggcactcc       960
     tgcgtttccc tcctccttgc ccaaggcgtg cacccacgca cggtgatgga gatcgtcggg      1020
     cacagcgcca tcgaaatgac catgaacgtc tacggccacg tcaacctgga gacccagagg      1080
     agggcactcg atgaactcga ccgaacgctg cggtag                                1116
//

If you have problems or comments...

PBIL Back to PBIL home page