(data stored in ACNUC30630 zone)

EMBL: CP001737.PE460

CP001737.PE460       Location/Qualifiers
FT   CDS_pept        528868..530541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0479"
FT                   /product="histidine kinase"
FT                   /note="PFAM: histidine kinase dimerisation and
FT                   phosphoacceptor region; ATP-binding region ATPase domain
FT                   protein; KEGG: scl:sce5432 putative two-component system
FT                   sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76898"
FT                   /db_xref="GOA:C8X729"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8X729"
FT                   /inference="protein motif:PFAM:PF07730"
FT                   /protein_id="ACV76898.1"
FT                   /translation="MDESAVPPGRTGVVRTEDVRTPSGSYARAMAHPAVRVAALTALAV
FT                   ALAGALTVTAGAGVPEWIFGSVTTFALLLVLDHGLRSWRLAGRERRRTRTVLAVAPEVA
FT                   AREAVVDERRRLAVDIAAGLRESLTAIGERATAAVTATDPTAAIQDVHREARRATADLR
FT                   RHLGLLRDPPLPAAPVPDPVAAPRVPNGPDLLVAATVTALAVIEAIAYPLLEGWPRSWL
FT                   SVALTGLAAAAIVGRRTAPGPAALAIGLTYLVALAFGAPVTGGFWCLATVGGVLWTIAI
FT                   RPTSTGRDASCAGFLVVSAGASAWLLDPDNAALLMLVMLVALAGASIVRFVRSRTHRAL
FT                   ERARVHEEEVGAATAAALASERTAFAREIHDTVSHAVGLIAVQAAAAEVSWPGDPAATR
FT                   QALGVIAATATAAHADLVRLSPHRPARPRRPADLCELIDRIRAGGTQVRVVGLELIPPA
FT                   RLDVAYRLLQETLTNVLRHGGGAAAEVSVAVGEDLRIVVADAGGDGSGSGDPVARRGYG
FT                   LIGLAERVSFAGGSMIAGPGPAGGYRVEVTLPPVADRVVT"
     atggacgaat cggcggtgcc gcccggacga accggggtcg tccgcacgga ggatgtccgg        60
     acgccgtcgg gttcctatgc tcgggcgatg gcgcaccccg cggtccgcgt cgccgccctc       120
     accgcactgg cggtggctct ggccggcgcg ctgacggtca cggccggtgc cggcgtcccg       180
     gaatggatct tcgggtcggt caccaccttc gcgctgctgc tggtgctcga ccacggcctc       240
     cgctcatggc ggctggccgg ccgggagcgc cgccgcaccc gcacggtgct cgccgtcgca       300
     cccgaggtgg cggcccggga ggcggtcgtc gacgagcggc gtcgactggc cgtcgacatc       360
     gctgcgggcc tgcgagagtc cctgacggcc atcggtgagc gggcgaccgc cgcggtcacc       420
     gccacggacc cgacggcggc catccaggac gtccaccgcg aggcccgccg ggccactgcc       480
     gacctgcgcc gccacctggg cctgctccgg gatccgccgc tccccgcagc gcccgtgccc       540
     gacccggtcg cggcgccacg ggtaccgaat gggccggacc tgctcgtcgc tgccacggtc       600
     accgccctcg ccgtcatcga ggcgatcgcc taccccctcc tcgaaggctg gccgcgaagc       660
     tggctctccg tcgcgctgac cggcttggcc gcggcagcca tcgtcggtcg gcgtaccgcc       720
     ccgggcccgg ccgcgctggc catcggcctg acctacctcg tcgcgttggc gttcggtgcg       780
     ccggtgacgg gcgggttctg gtgcctggcg acggtcggcg gagtgctctg gacgatcgcc       840
     atccggccca cgtcgacggg gcgggacgcg tcgtgcgccg ggttcctggt ggtgtccgcc       900
     ggagcatcgg cctggctgct ggatccggac aacgccgcgt tgctgatgct ggtcatgctc       960
     gtcgcgctgg ccggcgccag catcgtccgg ttcgtccgat cccgcaccca ccgggcgctc      1020
     gaacgcgccc gggtgcacga ggaggaggtc ggcgcggcca ccgctgccgc gctggcctcc      1080
     gagcggaccg ccttcgcccg cgagatccac gacaccgtct cgcacgcggt cggtctcatc      1140
     gcggtgcagg ccgccgccgc cgaggtcagt tggccgggtg acccggccgc cacccggcag      1200
     gccctcggcg tcatcgcggc gaccgcgacc gccgcccacg ccgatttggt ccgattgtcg      1260
     ccgcaccgtc cggctcggcc tcgacggccg gccgacctgt gcgagctgat cgaccggatc      1320
     agggcgggcg gcacccaggt ccgggtcgtc gggctcgagc tgatcccgcc cgcgcggctc      1380
     gacgtcgcct accggttgct gcaggaaacg ctgaccaacg tcctgcggca cggcggtggg      1440
     gcggcggccg aggtgagcgt ggccgtgggc gaggacctgc ggatcgtggt tgccgacgcg      1500
     ggcggggacg gatccgggtc gggcgacccg gtggcccgcc gtggatatgg attgatcggg      1560
     ctggccgaga gggtgagctt cgccgggggc tcgatgatcg ccggacccgg gccagccggc      1620
     gggtaccggg tcgaggtcac cctgcccccc gtcgccgacc gggtggtcac gtga            1674
//

If you have problems or comments...

PBIL Back to PBIL home page