(data stored in ACNUC30630 zone)

EMBL: CP001737.PE463

CP001737.PE463       Location/Qualifiers
FT   CDS_pept        complement(531867..533450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0482"
FT                   /product="YidE/YbjL duplication"
FT                   /note="TIGRFAM: YidE/YbjL duplication; PFAM: YidE/YbjL
FT                   duplication domain protein; TrkA-C domain protein; KEGG:
FT                   ank:AnaeK_1552 YidE/YbjL duplication"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76901"
FT                   /db_xref="GOA:C8X732"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006512"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:C8X732"
FT                   /inference="protein motif:TFAM:TIGR01625"
FT                   /protein_id="ACV76901.1"
FT                   /translation="MLQWFVDSPLLTIFFCVGVGSLLGKIKFGPVSFGPAGALFVALAL
FT                   SAIEPKVALPPIVTSLSLCVFCYMVGIAAGPSFVNALRSGWQPVVVSVLAIVAMAAAAL
FT                   GVGSWFGLDIGTVAGAFAGAGTATAALGAVQQQLAAGGPIPPEPAIGYAVAYPITVLLT
FT                   ILCCSYLISAGRRKPTAEDRKKLAPIAVRTLELVGDPALTVRGLSDRYQAVVSRLTRGG
FT                   TTVVAHDEEALADGDLLTITAREDEVQRMIGDLGRPAQEEPWMDRSDIDFRRITLSNSS
FT                   YVGRELVDLRLDEKYDAVVSRVRRGDVDIIATPDLVLASGDRLRVTAPREQLAAITKEL
FT                   GDSERTAGDINPVGLGLGLTLGLLAAFIEIPLPGGGTLVLGTATAPLILGVVLGALGRT
FT                   GPIIWALPGNVANTLNQYSLLVFLVAVGTGAGSGLITALAADWFPLVTLGLAISAAHAL
FT                   ICVIGLRTVLKYGTARSLGGLTGSQLNPAPYAFAIGKVPDQRVAIGYAVLFPVSMIVKV
FT                   LLAQLMVVYF"
     atgctgcaat ggttcgtcga cagcccgctg ctcaccatct tcttctgcgt gggcgtgggc        60
     agcctgctgg gcaagatcaa attcggcccg gtgtcgttcg gtccggccgg cgcgctgttc       120
     gtggcgttgg cgctgtccgc gatcgagccg aaggtcgcgc tgccgccgat cgtcacgagc       180
     ctgtccctgt gcgtcttctg ctacatggtc ggcatcgccg ccgggccgtc cttcgtcaac       240
     gcgctgcggt cgggctggca gccggtggtg gtgtcggtgc tggccatcgt ggcgatggcg       300
     gcggcggcac tcggtgtggg cagttggttc ggcctggaca tcggcaccgt tgccggcgcg       360
     ttcgccgggg cgggcaccgc caccgcggcg ctgggcgcgg tgcagcagca actggctgcc       420
     ggcggcccga tcccgccgga accggcgatc gggtacgcgg tggcctaccc gatcaccgtg       480
     ctgctgacca tcctgtgttg ctcgtacctg atcagcgcgg gacgccgcaa acccaccgcc       540
     gaggaccgga agaagctggc gccgatcgcg gtgcgcacgc tggagctggt gggcgacccg       600
     gccctgacgg tgcgcggact gtcggaccgc taccaggcgg tggtgtcccg gctgacccgc       660
     ggcgggacga cggtcgtcgc gcacgacgag gaggccctgg ccgacggaga cctgctgacg       720
     atcaccgcgc gcgaggacga ggtccagcgg atgatcggcg acctgggccg gccggcccag       780
     gaggaaccgt ggatggacag gtcggacatc gacttccgcc ggatcaccct gtccaacagc       840
     tcctacgtcg gccgcgagct ggtggacctg cggctcgacg agaagtacga cgcggtggtc       900
     agccgggtcc ggcggggtga cgtcgacatc atcgccacgc ccgacctggt gctggccagc       960
     ggcgaccggc tgcgggtgac ggcgccgcgg gagcagctgg ccgcgatcac caaggagctg      1020
     ggcgattccg agcggacggc cggcgacatc aatccggtcg ggctcggtct gggcctgacc      1080
     ctgggcctgc tggccgcgtt catcgagatc ccgctgccgg gcggcgggac gctggtgctg      1140
     ggcaccgcga ccgccccgct gatcctgggc gtggtgctgg gtgcgctggg ccggaccggc      1200
     ccgatcatct gggcgctgcc cgggaacgtc gccaacacgc tgaaccagta ctcgctgctg      1260
     gtcttcctgg tcgcggtcgg cacgggcgcc gggtccgggc tgatcaccgc cctggccgcc      1320
     gactggttcc cgctggtcac cctgggcctg gccatctccg ccgcgcacgc gctgatctgc      1380
     gtcatcgggc tgcggaccgt gctgaagtac ggcaccgccc gctctttggg cgggctcacc      1440
     ggctcacaac tgaacccggc gccgtacgcg ttcgccatcg gcaaggttcc cgaccagcgt      1500
     gtcgcgatcg gctacgcggt gctgttcccg gtgagcatga tcgtcaaggt gctgctggcg      1560
     cagctgatgg tggtgtactt ctga                                             1584
//

If you have problems or comments...

PBIL Back to PBIL home page