(data stored in ACNUC30630 zone)

EMBL: CP001737.PE466

CP001737.PE466       Location/Qualifiers
FT   CDS_pept        537363..537821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0485"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: cak:Caul_0809 MarR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76904"
FT                   /db_xref="GOA:C8X735"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8X735"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACV76904.1"
FT                   /translation="MTPPVPAAGRSQLETQLLRQVQVTGSMAEQALARRLGVNGTDLAA
FT                   MGHVSAAEPPIGPRDLSQRLGLSPAAVTEVVDRLESAGHLVRERDTLDRRRVRLRPSAP
FT                   ATTRVLAELAPLMHDLDELAETFDDAERAAIRRYLRGVVDAFTRFQLP"
     atgacgccac cagtgccggc ggccggccgc agccagctgg aaacgcagtt gttgcgtcag        60
     gtccaggtga ccgggtcgat ggccgagcag gccctggccc gccggctggg cgtcaacggc       120
     accgacctgg ccgccatggg ccacgtcagc gcggccgaac cgccgatcgg cccgcgcgac       180
     ctgagccagc ggctggggct cagccccgcc gccgtcaccg aggtggtcga ccggttggag       240
     agcgcgggac acctggtccg cgagcgcgac accctggacc ggcggcgggt ccggctgcgg       300
     ccctcggccc cggccaccac ccgggtgctg gccgaactgg cccccctgat gcacgacctg       360
     gacgagctgg ccgagacatt cgacgacgcc gaacgggccg cgatccggcg ctacctgcgg       420
     ggggtcgtgg acgccttcac ccggttccag ctgccctga                              459
//

If you have problems or comments...

PBIL Back to PBIL home page