(data stored in ACNUC30630 zone)

EMBL: CP001737.PE467

CP001737.PE467       Location/Qualifiers
FT   CDS_pept        complement(537799..539025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0486"
FT                   /product="putative signal transduction histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; KEGG:
FT                   bpy:Bphyt_2660 integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76905"
FT                   /db_xref="GOA:C8X736"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8X736"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACV76905.1"
FT                   /translation="MTQVQQIVRDAAQRGLNLQLTLRALLAAFVLGTLAFLPPADAAEL
FT                   SWWVAGGYLVAVAGLTLWLRRGDRIALTWGWLGLYVDLIALLTLTQIAGWSADQSWTSY
FT                   VLQFGFFLIPVLAATQLRWGVCAGVVIPTVLLYAAEGLLTRDANEVEPIPSIVLRVVAL
FT                   AGVGLAAVWLSRIQRSRVASIQALVDDRTRLLTELMTATDSAHRAMAENLHDGALQYVL
FT                   AARMDLEDARDGAPDEAARSFDRLDDALTQTAKLLRSTVSELHPAVLEQSGLALAVGQL
FT                   AGTAAERGGLTVSVESAGWPDEARTDQDQLLFGVARELISNVVRHAHASRMAIGLELAD
FT                   GVAELTVSDDGIGFTPGTAARKLSEGHIGVDSQRVKVEAAGGRFSVDSPAAGGATVRVQ
FT                   VPVRAAGTG"
     gtgacgcagg tccaacagat cgtccgcgac gccgcccagc gcgggctgaa cctgcagttg        60
     acgctgcgag cgctgctggc cgccttcgtg ctcggcaccc tggcgttcct gccgcccgcg       120
     gacgccgccg agctgtcctg gtgggtggcc ggcggttacc tggtcgcggt ggccgggctg       180
     accctgtggc tgcgccgggg cgaccggatc gcgctgacct ggggctggct gggtctctac       240
     gtcgacctga tcgccctgct cacgctgacc cagatcgccg gctggtcggc cgatcagagc       300
     tggacctcct acgtcctgca gttcggcttc ttcctcatcc cggtgctggc cgccacccag       360
     ttgcgctggg gcgtgtgcgc cggcgtggtg atcccgacgg tgctgctgta cgcggccgag       420
     ggcctgctca cccgcgacgc caacgaggtc gagccgatcc cgtcgatcgt gctgcgggtg       480
     gtcgcgctgg ccggcgtcgg cctggccgcg gtctggctgt cccggatcca gcggtcgcgg       540
     gtggcctcga tccaggcgct ggtggacgac cggacccggt tgctgaccga gctgatgacc       600
     gcgaccgaca gcgcccaccg ggcgatggcc gagaacctgc acgacggcgc cctgcagtac       660
     gtgctggccg cccggatgga tctggaggac gcccgggacg gcgccccgga cgaggccgcg       720
     cggtccttcg accggctcga cgacgcgctc acccagacgg ccaagctgtt gcgctcgacc       780
     gtctccgagc tgcacccggc cgtgctggag cagtccgggc tggccctggc ggtcgggcaa       840
     ctggccggca cggcggccga acggggcggg ctgacggtgt cggtggagtc cgccggctgg       900
     cccgacgagg cccgcaccga tcaggatcag ctgctgttcg gggtggcccg ggagctgatc       960
     agcaacgtcg tccggcacgc gcacgcgtcg cggatggcga tcgggctgga gctggccgac      1020
     ggggtggccg agctgaccgt gagcgacgac ggcatcgggt tcaccccggg gacggcggcc      1080
     cgcaagctgt ccgaggggca catcggggtc gactcgcagc gggtcaaggt ggaggcggcc      1140
     ggcggccggt tcagcgtgga cagcccggcc gccggcggcg ccacggtccg ggtgcaggtg      1200
     ccggtcaggg cagctggaac cgggtga                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page