(data stored in ACNUC30630 zone)

EMBL: CP001737.PE472

CP001737.PE472       Location/Qualifiers
FT   CDS_pept        543469..543801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0491"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   scl:sce1170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76910"
FT                   /db_xref="GOA:C8X741"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C8X741"
FT                   /inference="protein motif:PFAM:PF03992"
FT                   /protein_id="ACV76910.1"
FT                   /translation="MLIVHVDIAVEPGRVDEFLRATIENATASIQEPGVIRFDAIQDEA
FT                   DPAHVVLVEIYTGADAAATHKETAHYATWRDTVAEMMARPRSSTKYTAVFPVAEADWSS
FT                   AASDRA"
     atgctgatcg ttcacgtcga catcgccgtc gaacccggcc gggtcgacga gttcctgcgc        60
     gccaccatcg agaacgcgac cgcctcgatc caggaaccgg gcgtcatccg gttcgacgcg       120
     atccaggacg aggccgaccc cgcgcacgtc gtgctggtcg agatctacac cggcgccgac       180
     gcggccgcca cgcataagga gaccgcgcac tacgcgacct ggcgggacac ggtcgccgag       240
     atgatggccc ggccccgctc gtcgaccaag tacacggcgg tcttcccggt cgccgaggcc       300
     gattggagct ccgcggccag tgatcgcgcg tga                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page