(data stored in ACNUC30630 zone)

EMBL: CP001737.PE480

CP001737.PE480       Location/Qualifiers
FT   CDS_pept        554198..554866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0499"
FT                   /product="Hemerythrin HHE cation binding domain protein"
FT                   /note="PFAM: Hemerythrin HHE cation binding domain protein;
FT                   KEGG: dar:Daro_0364 ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76918"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:C8X749"
FT                   /inference="protein motif:PFAM:PF01814"
FT                   /protein_id="ACV76918.1"
FT                   /translation="MTAATNARPDTFEMVFVHNAFRQQFGAMPGLIRGVADGDRDRASV
FT                   VVGFFTEMTRSLHHHHEAEDDLMWPLLLQRAPMDSALILRMEEQHERIAELYRCAERSA
FT                   VTFAERADPVSREQWAANLDELIDALTEHLHDEEVEVLPLVEKVLTVPEWEALGERGRA
FT                   GIPKDRLLVFLGFLLQANTPEHGRDFLGRMPPPARLAWAVLGRRSFRKEYRRVYGVDPS
FT                   "
     atgaccgccg ccaccaatgc ccgcccggac accttcgaga tggtgttcgt gcacaacgcc        60
     tttcgccagc agttcggggc gatgcccggg ctcatccgcg gggtcgccga cggcgaccgg       120
     gaccgggcga gcgtcgtcgt cgggttcttc accgagatga cccgatcgct gcaccaccac       180
     cacgaggccg aggacgatct gatgtggccc ctgctgctgc agcgggcacc gatggactcg       240
     gcgctgatct tgcggatgga ggagcagcac gagcggatcg ccgagctcta ccggtgcgcc       300
     gaacgcagcg cggtcacctt cgcggagcgg gccgatccgg tcagccgcga gcagtgggcg       360
     gccaacctgg acgagctgat cgacgcgctg accgagcacc tgcacgacga ggaggtcgag       420
     gtcctgccgc tggtggagaa ggtgctgacg gtgcccgagt gggaggccct gggggagcgc       480
     ggtcgggccg gcatccccaa ggaccggctg ctggtgttcc tcgggttcct gttgcaggcc       540
     aacacccccg agcacggccg ggacttcctg ggtcggatgc ccccgccggc ccggctggcc       600
     tgggcggtgc tcggccgccg gtccttccgc aaggagtacc ggcgcgtcta cggggtcgac       660
     ccgtcctga                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page