(data stored in ACNUC30630 zone)

EMBL: CP001737.PE485

CP001737.PE485       Location/Qualifiers
FT   CDS_pept        558610..559548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0504"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76923"
FT                   /db_xref="GOA:C8X754"
FT                   /db_xref="UniProtKB/TrEMBL:C8X754"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76923.1"
FT                   /translation="MDGEPIGGIAGRRAAVAIAVSLGVVLLVAAAVVLVTGNTGVAGEA
FT                   VAAPVSERPQAGDCLLDDPIGVVYGSPGGSSELPALRTAACDGARYGEVVTIGAGTDQD
FT                   TAADDGTQDQCWSAAYGYLGVPDPVTTDLDRVPVADVWPLLIGPDDRQRAAGQVWSACV
FT                   VHLAPSKSDDGVTIDHSLRGAWARPEDAHLFSMCLVDGDSQDPINCAWSHGAEQISYAW
FT                   GDSTQTPETATAACRADAVDALGSPAALDRGDLAVSVVASRYDDGELVTGPEAASADGD
FT                   YFLDCLLVPARAGQELVGPLRGLGEAPAPLR"
     gtggacgggg agccgatcgg ggggatcgcg ggccgccggg cggccgtcgc gatcgcggtg        60
     agcctggggg tggtgttgct ggtcgcggcg gccgtggtgc tggtcacggg caacaccggg       120
     gtcgccggtg aggcggtggc cgcgccggtg tccgagcggc cgcaggccgg tgactgcctg       180
     ctggacgacc cgatcggcgt ggtctatggc tcgccgggtg gctccagcga gttgcccgcc       240
     ctgcgaaccg cggcctgtga cggggcccgg tacggcgaag tggtcaccat cggcgccggc       300
     accgaccagg acaccgccgc cgacgacggc acccaggacc agtgctggag tgccgcctac       360
     gggtacctgg gcgtcccgga cccggtgacc acggacctgg accgggttcc ggtggccgat       420
     gtctggcccc tgctgatcgg ccccgacgat cggcagcggg ccgccggtca ggtctggtcg       480
     gcgtgcgtgg tccacctggc ccccagcaag tccgacgacg gggtcacgat cgaccattcc       540
     ctgcgcgggg cctgggcccg acccgaggac gcgcacctgt tctcgatgtg cctggtggac       600
     ggcgactcgc aggatccgat caactgcgcc tggagtcacg gcgccgagca gatcagctat       660
     gcgtggggcg actcgaccca gacgccggag acggccaccg cggcctgccg ggccgatgcc       720
     gtcgatgcgc tcggctcgcc ggccgcgctg gaccgcggcg acctggccgt ctcggtggtc       780
     gcgtccaggt acgacgacgg ggagctggtc accggtcccg aggcggccag cgcggacggc       840
     gattacttcc tggactgcct gctggtgccg gcccgggccg gtcaggagct ggtcggtccg       900
     ctgcgcgggc tcggcgaggc gcccgctccg ctgcggtga                              939
//

If you have problems or comments...

PBIL Back to PBIL home page