(data stored in ACNUC30630 zone)

EMBL: CP001737.PE488

CP001737.PE488       Location/Qualifiers
FT   CDS_pept        562148..566197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0507"
FT                   /product="ATP-dependent helicase HrpA"
FT                   /note="KEGG: esa:ESA_01693 ATP-dependent RNA helicase HrpA;
FT                   TIGRFAM: ATP-dependent helicase HrpA; PFAM:
FT                   helicase-associated domain protein; protein of unknown
FT                   function DUF1605; helicase domain protein; SMART: DEAD-like
FT                   helicase; helicase domain protein; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76926"
FT                   /db_xref="GOA:C8X757"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010222"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8X757"
FT                   /inference="protein motif:TFAM:TIGR01967"
FT                   /protein_id="ACV76926.1"
FT                   /translation="MSVHQAPDAERTERLADLTIVDRRRLQGRLRSAERIPDPAKRDLV
FT                   LAEIDHQLEAGAARLARRQAAVPTITFPAQLPVSARVQDLARTIAEHQVVIVAGETGSG
FT                   KSTQLPKLCLQLGRGVRGMIGHTQPRRIAARALAERIAEETGTQLGGAIGYSIRFGDHT
FT                   GPTTLVKLMTDGILLTEIARDRMLWAYDTIIIDEAHERSLNIDFLLGYLQGLLPQRPDL
FT                   KLIITSATIDPGKFSRHFADAPVVEVSGRTFPVEIRYRPYGLDALPEVDDPDAEQSRGS
FT                   SESADQGQAITAAVDELLAAGDGDILVFLSGEREITDTTEVLRGHLAGRRGLTEVLPLY
FT                   GRLSSADQHKVFSAHPGRRIVLSTNVAETSLTVPGIRYVIDPGTARISRYSPRSKVQRL
FT                   PIEPISQASAGQRAGRCGRVANGICIRLYSEKDFDERPAYTDPEIARTSLASVILQMAA
FT                   LELGDIVDFPFLDPPDQRQITDGVTVLTELGAIDRSAGDRVRLTPTGREMADLPLDPRL
FT                   ARMLVEGERRNVRREMLVLVSALAVIDVREYPLDERDKATAAHARFVDGNSDFNALISL
FT                   WAYLEEQAKTQSGNAFRRMCRREYLNYLRIREWQDLHAQLSQLLDGGRRRGGRRRPDRP
FT                   APADRGSLPQRRDPDATQGGRGSLAVDVDTERVHTALLAGLLSHIGLRKEGTREYQGTR
FT                   GISYSIWPGSALARTGPVLVVAAELVETSRLWARICARVEPGWVEQVGADLLRRNYSEP
FT                   RWNGKRASVEATEKVTLLGVTLIAARTVQFDRIDPELSRELFIRHALVERDWQTRHRFF
FT                   ADNQRALEQVTEWEERARRRDILIDDDTMFALYDARIPPQVTSGRHFDSWWKKASRTQP
FT                   DLLTLTPDMLIAAGAERFDSAAFPDRFTSGEVELPLDYVFDPGRADDGVTVSIPLPVLA
FT                   RVDPAGFEAQIPGLRADLAVALIRTLPKTLRRNFVPAPDFARAALDRIDAARPLAEELA
FT                   GALTRMTGVVVRTADFDPDKVPEHLRMNFRIVDEHGATVASGRDLPTLQSTLRTDTQRA
FT                   VVQATKSLERHGLTAFPEPGVPRRVRARVAGHEVTGYPALVVEGPGTVGVAVFDSEADQ
FT                   RRAMRAGTIELLAAALTPSLTRVRQLLTREQQITLATAPGTTIPTLVADATRAAVDALL
FT                   DWAGGPSWSAAGFAAVRTKLTPSMLTSVRDVLAAAETVLSAAGAAARALDTAERGPGAA
FT                   AVADLTRDMRAQWRAAVAPGFIVATGAAGLPDRARQLQALRIRAERVREAAGRDRERLA
FT                   EIRELQAEVDRAVEELPEERRSDPDVQALHHLLAEYRVALFAQPMRTSVPVSAKRIRSA
FT                   AAALGG"
     atgagcgtgc atcaggcccc ggacgccgaa cggaccgaac ggctggccga cctgaccatc        60
     gtcgaccggc gtcggctgca ggggcggctg cgcagtgccg aacggatccc ggacccggcc       120
     aaacgcgacc tggtgctggc cgagatcgat caccagctcg aggccggggc agcccggctg       180
     gcccggcgtc aggccgcggt ccccacgatc accttcccgg cccagctgcc ggtctcggcc       240
     cgggtgcagg acctggcccg caccatcgcc gagcaccagg tggtgatcgt ggccggggag       300
     accgggtcgg gcaagtcgac ccagttgccc aagttgtgtc tgcagctggg gcggggggtc       360
     cgcggcatga tcgggcacac ccagccccgg cggatcgccg cccgggcgct ggccgaacgg       420
     atcgccgagg agaccggcac ccagctgggc ggcgcgatcg gctactcgat ccggttcggc       480
     gaccacaccg gcccgaccac cctggtcaag ctgatgaccg acggcatcct gctcaccgag       540
     atcgcccggg accggatgct gtgggcctac gacacgatca tcatcgacga ggcccacgag       600
     cgaagcctga acatcgactt cctgctgggc tacctgcagg gcctgctgcc gcagcgtccc       660
     gatctcaagt tgatcatcac ctcggccacc atcgatcccg gcaagttctc ccgccacttc       720
     gccgacgccc ccgtcgtcga ggtctccggg cggaccttcc cggtcgagat ccgttaccgg       780
     ccctacggtc tggacgcgct gccggaggtg gacgatccgg acgccgagca gtcccgcggt       840
     tcctccgaat cggccgacca gggtcaggcg atcaccgccg cggtcgacga gctgctggcc       900
     gccggggacg gcgacatcct ggtcttcctg tccggcgagc gggagatcac cgacaccacc       960
     gaggtgttgc gcggccacct ggccggccgg cggggcctga ccgaggtgct cccgctgtac      1020
     gggcggctgt cctcggccga tcagcacaag gtcttctccg cgcaccccgg acggcggatc      1080
     gtgctgtcca ccaacgtggc cgaaacctcg ctgaccgtcc ccgggatccg gtacgtgatc      1140
     gaccccggca ccgcccggat ctcgcggtac tcgccgcgca gcaaggtgca gcggctgccg      1200
     atcgagccga tctcgcaggc ctcggccggt cagcgggccg gccgctgcgg ccgggtggcc      1260
     aacggcatct gcatccggct gtactcggag aaggacttcg acgagcggcc cgcctacacc      1320
     gacccggaga tcgcccgcac ctcgctggcc tcggtcatcc tgcagatggc cgccctggaa      1380
     ctcggcgaca tcgtcgactt cccgttcctg gacccgcccg accagcggca gatcaccgac      1440
     ggcgtcaccg tgctcaccga gctgggggcg atcgaccgca gcgccggcga ccgggtccgg      1500
     ctgaccccga ccggccggga gatggccgac ctgccgctgg atccccggct ggcccggatg      1560
     ctggtggagg gcgagcggcg caacgtccgg cgggagatgc tcgtgctggt ctccgcgctg      1620
     gccgtcatcg acgtccgcga gtacccgctg gacgagcggg acaaggcgac cgccgcgcac      1680
     gcccgtttcg tcgacggcaa ctcggacttc aacgccctga tcagcctctg ggcgtacctg      1740
     gaggagcagg cgaaaactca gtccggcaac gcctttcgcc ggatgtgccg ccgcgagtac      1800
     ctgaactacc tgcgcatccg ggaatggcag gacctgcacg cccagctcag ccaactgctc      1860
     gacggcgggc gccgtcgcgg tggccggcgc cggccggatc ggcccgcccc ggccgaccgg      1920
     ggcagcctgc cccagcgacg cgatccggac gccactcagg gtggccgcgg ctcgctggcc      1980
     gtggacgttg acaccgagcg ggtgcacacc gccctgctgg ccgggctgct ctcgcacatc      2040
     gggctgcgca aggagggcac ccgcgaatac cagggcaccc gcggcatctc ctactcgatc      2100
     tggcccggct cggcgctggc ccgcaccggc ccggtcctgg tggtggccgc cgaactggtc      2160
     gagaccagcc ggttgtgggc gcggatctgc gcccgggtcg aacccggctg ggtcgagcag      2220
     gtcggcgcgg acctgttgcg ccgcaactac tccgaaccgc ggtggaacgg caagcgggcc      2280
     agcgtggagg ccaccgagaa ggtgaccctg ctcggcgtca ccctaatcgc cgcccgcacg      2340
     gtgcagttcg accggatcga cccggaactg tcccgggaac tgttcatccg ccatgccctg      2400
     gtcgagcggg actggcagac ccggcaccgg ttcttcgccg acaaccaacg ggccctggaa      2460
     caggtcaccg agtgggagga acgggcccgg cggcgggaca tcctgatcga cgacgacacc      2520
     atgttcgccc tctacgacgc gcggatcccg ccgcaggtca cctcgggccg gcacttcgac      2580
     tcctggtgga agaaggcctc ccgcacccag cccgacctgc tcacgctcac cccggacatg      2640
     ctgatcgcgg ccggcgccga gcggttcgac tcggccgcgt tccccgaccg gttcacctcc      2700
     ggcgaggtgg agctgccgct ggactacgtg ttcgaccccg gtcgggccga cgacggggtg      2760
     accgtgagca tcccgctgcc cgtgctggcc cgggtggacc cggccggctt cgaggcccag      2820
     attcccggcc tgcgcgccga tctggccgtc gcgctgatcc gcaccctgcc caagacgctg      2880
     cggcgcaact tcgtgcccgc ccccgatttc gcccgggccg cgttggaccg tatcgatgcc      2940
     gcccgcccgc tggccgaaga acttgccggc gcgttgaccc ggatgaccgg ggtggtcgtc      3000
     cgtacggccg acttcgaccc ggacaaggtg cccgagcacc tgcggatgaa cttccgcatc      3060
     gtcgacgagc acggcgccac cgtggccagc ggccgggacc tgccgacgct gcagtcgacg      3120
     ctgcgcacgg acacccagcg ggcggtggtc caggccacca agtcgctgga acgccatggc      3180
     ctgaccgcct ttcccgagcc cggggtgccg cggcgggtgc gggcgcgggt ggccgggcac      3240
     gaggtcaccg ggtacccggc gctggtggtg gaggggccgg gcaccgtcgg tgtagccgtc      3300
     ttcgacagcg aggccgacca gcgccgcgcc atgcgggccg gcaccatcga gctgctggcc      3360
     gccgcgctga ccccgtcgct gacccgggtc cggcagctgc tcacccgcga gcagcagatc      3420
     accctggcca ccgcgcccgg caccaccatc ccaaccctgg tcgccgacgc cacccgggcc      3480
     gcggtggacg ccctgctcga ctgggcgggc gggccgagct ggagtgcggc cggcttcgcc      3540
     gcggtccgga ccaagctgac gccgagcatg ctcacgtcgg tccgcgacgt gctggccgcc      3600
     gccgagacgg tgctcagcgc ggccggcgcg gccgcgcgag cgctggacac cgcggagcga      3660
     ggcccagggg cggccgcggt cgccgacctg acccgggaca tgcgcgccca gtggcgggcg      3720
     gcggtggccc ccgggttcat cgtggccacc ggcgcggccg gcctgcccga ccgggcccgg      3780
     cagctgcagg cactgcggat ccgggcggag cgggtccgcg aggcggccgg gcgggaccgg      3840
     gagcgcctcg ccgagatccg cgaattgcag gccgaggtgg accgcgcggt cgaggagctc      3900
     cccgaggagc gccggtcgga cccggacgtg caggccctgc accacctgct ggccgagtac      3960
     cgcgtcgccc tgttcgcgca gccgatgcgc acgtcggtgc cggtctcggc caagcgcatc      4020
     cgatcggccg ccgcggcgct gggcggctga                                       4050
//

If you have problems or comments...

PBIL Back to PBIL home page