(data stored in ACNUC30630 zone)

EMBL: CP001737.PE489

CP001737.PE489       Location/Qualifiers
FT   CDS_pept        566249..567295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0508"
FT                   /product="Dipeptidylaminopeptidase/acylaminoacyl-peptidase-like
FT                   protein"
FT                   /note="KEGG: ara:Arad_7409 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76927"
FT                   /db_xref="GOA:C8X758"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C8X758"
FT                   /inference="protein motif:COG:COG1506"
FT                   /protein_id="ACV76927.1"
FT                   /translation="MKPARTAIAVLAGALLLAACGSAATPRPAPASTTAPSASVPSAVG
FT                   PAAPVDPAGPAASDDPAGPPSEQAGDPSGDAPGDPSGALPAAFSDDETMVWIPAGDHRV
FT                   PGTLALPAAAPGRPVPAVLLLHGDLSSRDENAQMFARLAAALAARGIASLRIDFAGTGD
FT                   SEEPDLALDYPDMVADATASLDYLRADEVVDPARVAVLGLSRGGGVGATVTGTEPGVAA
FT                   FVSWSGAVYNGYDEDPDGHDLAREDGYVPLDVGDRTFKLGLNWFDTIEQSHPLDDISGY
FT                   TGPVLAVVGSDDQIVDPEVSTIFLDTVASPDTTLHVVDGADHGFSADQAVGDEAIGVTT
FT                   DWLVARLG"
     gtgaaaccgg cccggacagc gatcgccgtg ctggcgggcg ccctgctgct cgccgcctgc        60
     ggatcggccg cgaccccgcg gccggccccg gcgtccacca ccgcgccgtc ggcgagcgtc       120
     ccgtccgccg tcgggccggc cgccccggtc gatcccgccg gcccggccgc gtcggacgat       180
     cccgccggtc cgccgtccga acaggccggc gacccgtccg gagacgcgcc cggggacccg       240
     tccggcgctc tgccggcggc gttctccgac gacgagacga tggtctggat cccggccggc       300
     gaccatcgcg tccccggcac gctcgccctt cccgcggcgg cccccggccg gccggtgccg       360
     gcggtgctgc tgctgcacgg cgatctgagc agccgggacg agaacgcgca gatgttcgcg       420
     cggctggcgg cggcgttggc ggcgcggggc atcgcctcgc tgcgcatcga cttcgccgga       480
     accggggatt cggaggaacc cgatctggcc ctcgactacc ccgacatggt cgccgacgcc       540
     accgcgtccc tggactacct gcgcgccgat gaggtcgtcg acccggcccg ggtggccgtc       600
     ctgggcctgt cccgtggcgg cggcgtcggg gcgacggtga cgggcaccga gccgggtgtc       660
     gcggccttcg tctcctggag cggggccgtc tacaacgggt acgacgagga cccggacggc       720
     catgacctgg cccgcgagga tgggtacgtg ccgctggatg tcggcgaccg cacgttcaag       780
     ctcgggctga actggttcga caccatcgag cagtcgcacc cgttggacga catcagcggc       840
     tacaccgggc cggtgctggc cgtggtcggc tccgacgacc agatcgtgga cccggaggtg       900
     tcgacgatct tcctggacac cgtggccagc cccgacacca ccttgcatgt ggtggacggg       960
     gccgaccacg gcttctcggc cgaccaggcc gtgggggacg aggcgatcgg cgtcaccacc      1020
     gactggctcg tcgcccggct cggctga                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page