(data stored in ACNUC30630 zone)

EMBL: CP001737.PE494

CP001737.PE494       Location/Qualifiers
FT   CDS_pept        complement(571443..572387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0513"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: xop:PXO_00881 ABC
FT                   transporter sugar permease"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76932"
FT                   /db_xref="GOA:C8X763"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8X763"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV76932.1"
FT                   /translation="MATTTALPGAVAGPGGARVDPGISRRRRQTLIAWLFALPFVLVFS
FT                   VFMVFPLLSSFLMSFTDFTSRDVTTPLAVGFVGIDQYADLFGNPQFLRSLVNTGYFVIV
FT                   GIPLTMMVALLLAVALNSGITKFRTVFRVGFYTPVVTSIVAIAVVWRFILQPDGLLNSV
FT                   LSWVGITGPDWLNSTTWAMPALILMAVWRSMGTLMIIFPAGLQTIPEDVKEAAAIDGAG
FT                   PWQRFARITLPLLRPTLLLGAVLSSVGYLQFFEEPFVMTKGGPLDSTLSISYFTFNQFG
FT                   FGKYGYASAASYVLFVAIALLSVVQFRALRSKD"
     atggccacca ccaccgccct cccgggggcc gtcgccggcc ccgggggggc gcgggtcgac        60
     cccggcatct cgcgccgccg ccggcagacg ctcatcgcct ggctgttcgc cctgccgttc       120
     gtcctggtct tcagcgtgtt catggtgttc ccgctgctgt cctcgttcct gatgtcgttc       180
     accgacttca ccagccgcga cgtcaccacc ccgctggccg tcggcttcgt cgggatcgac       240
     cagtacgccg acctcttcgg caacccgcaa ttcttgcgtt cgctggtcaa caccgggtac       300
     ttcgtgatcg tcgggattcc gctgaccatg atggtcgcgc tgctcctggc ggtcgccctg       360
     aacagcggaa tcaccaagtt ccgcaccgtg ttccgggtcg gcttctacac cccggtggtg       420
     accagcatcg ttgccatcgc ggtggtctgg cggttcatcc tgcaaccgga cggcctgctc       480
     aactcggtgc tgagctgggt cggcatcacc ggtccggact ggctgaacag cacgacctgg       540
     gccatgccgg cgctgatcct gatggccgtc tggcgcagca tgggcacgct gatgatcatc       600
     ttcccggccg gcctgcagac catcccggag gacgtcaagg aggccgccgc gatcgacggc       660
     gccggaccgt ggcagcggtt cgccaggatc accctgccgt tgctgcggcc caccctgctg       720
     ctcggcgccg tcctgtcctc ggtcgggtac ctgcagttct tcgaggaacc cttcgtgatg       780
     accaagggcg gcccgctgga ctcgaccctg tcgatcagct acttcacctt caaccagttc       840
     gggttcggca agtacggcta cgcctcggcg gccagttacg tgctgttcgt ggcgatcgcc       900
     ctgctcagcg tcgtccagtt ccgcgccctg cgatccaagg actga                       945
//

If you have problems or comments...

PBIL Back to PBIL home page