(data stored in ACNUC30630 zone)

EMBL: CP001737.PE5

CP001737.PE5         Location/Qualifiers
FT   CDS_pept        5927..6493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0005"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   pca:Pcar_2226 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76443"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHV2"
FT                   /inference="protein motif:PFAM:PF05258"
FT                   /protein_id="ACV76443.1"
FT                   /translation="MPEDPAPRVPSGSGPSGSAGRGSDLAREALAAARASNAARRKAAG
FT                   RTPRTGSGSAGNLRRRRWSGSGPDAARDPQPLGLTMRSWVKAAGTGADLTKATLFGRWE
FT                   KIVGDEVAQRCSPTSLVDGELVVQAESTAWATQIRMLAPQLLVKINAELGPRTVIRIRA
FT                   KGPAGPSWRFGERHVRGRGPRDTYG"
     atgcccgagg accccgcacc gcgcgtcccc tccggttcgg gaccgtccgg ttcggccggg        60
     cgcggctcgg acctggcccg cgaggcgctg gccgcggccc gggccagcaa cgcggcccgg       120
     cgcaaggcgg ccggccggac cccgcggacc ggatccgggt cggccggcaa tctgcgccgc       180
     cgccgctggt cgggctccgg cccggacgcc gcccgcgatc cgcagccgct cggcctgacc       240
     atgcggtcct gggtgaaggc ggcgggcacc ggtgccgatc tgaccaaggc cacgctcttc       300
     ggccgctggg agaagatcgt cggtgacgag gtcgcccaac gatgctcgcc gacctcgctg       360
     gtcgacggcg agctggtggt gcaggccgag tccaccgcct gggccaccca gatccggatg       420
     ctcgcgcccc agttgctggt caagatcaac gccgagctgg gtccccggac cgtgatccgg       480
     atccgggcca agggcccggc cggcccgtcc tggcggttcg gcgagcggca cgtgcgcggc       540
     cgtggccctc gcgacaccta cggctga                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page