(data stored in ACNUC30630 zone)

EMBL: CP001737.PE501

CP001737.PE501       Location/Qualifiers
FT   CDS_pept        complement(579643..580341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0521"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sil:SPOA0347 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76939"
FT                   /db_xref="GOA:C8X770"
FT                   /db_xref="UniProtKB/TrEMBL:C8X770"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76939.1"
FT                   /translation="MTSTVTPTAGIQTTAESRTGRVLTRLGGIALIASPLLTLGGNLTS
FT                   PPQPDESSAGYIASLAADPGISAVSAGLYHYGWITLAFGVLAAIGLVRGPRGRAWTAAA
FT                   AVIAAFGAMQFSGFLLADHYVAALGVLPPDVGAGIFDAANGSIWTQFWLSSAMVTALLG
FT                   VPLMLAGLARAGVIGWWAAPVYVAVWVVPAFLPAPWGALVAGLASAPLVVVGLRLIQRA
FT                   NLTVPQPVAG"
     atgaccagca ccgtcacccc taccgccggc atccagacca cggccgagtc ccgcaccggc        60
     cgggtgctca cccgcctcgg cgggatcgcg ctcatcgcgt ccccgctgct gaccctgggc       120
     ggcaacctca cctcgccgcc gcagcccgac gagagctcgg ccggctacat cgcctcgctg       180
     gctgccgatc ctggaatctc ggcggtgtcg gcggggctgt accactacgg ctggatcacg       240
     ctggccttcg gcgtgctggc ggcgatcggg ctggtccggg gtccgcgcgg gcgggcgtgg       300
     accgccgccg ccgcggtgat cgccgccttc ggcgccatgc agttctccgg attcctgctg       360
     gccgaccact acgtcgccgc cctcggggtg ctgccaccgg acgtcggcgc cggcatcttc       420
     gacgccgcga acggcagcat ctggacccag ttctggctgt ccagtgccat ggtgaccgcc       480
     ctgctgggcg tcccactgat gctggccggg ctggcccggg ccggcgtcat cggctggtgg       540
     gcggcaccgg tctacgtggc cgtctgggtc gtcccggcgt tcctgcccgc gccgtggggt       600
     gccctggtcg ccgggctggc ctcggcgccg ctggtggtgg tcggcctgcg gctcatccag       660
     cgggcgaatc tgaccgtccc gcagccggtc gccggctga                              699
//

If you have problems or comments...

PBIL Back to PBIL home page