(data stored in ACNUC30630 zone)

EMBL: CP001737.PE508

CP001737.PE508       Location/Qualifiers
FT   CDS_pept        587219..588424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0528"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /EC_number="1.13.11.27"
FT                   /note="KEGG: expressed hypothetical protein; K00457 4-
FT                   hydroxyphenylpyruvate dioxygenase; TIGRFAM:
FT                   4-hydroxyphenylpyruvate dioxygenase; PFAM:
FT                   Glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76946"
FT                   /db_xref="GOA:C8X777"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR005956"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041735"
FT                   /db_xref="InterPro:IPR041736"
FT                   /db_xref="UniProtKB/TrEMBL:C8X777"
FT                   /inference="protein motif:TFAM:TIGR01263"
FT                   /protein_id="ACV76946.1"
FT                   /translation="MTLSFEDTRRAAPDEPTDEALRDLVGLVDHDVTTDPFPVLGMDAV
FT                   VFVCGNATQSAQYFQAVWGMDPFAYRGPETGHRGDVAYALKSGSARFVLTGGVAPDSPL
FT                   LDIHREHGDAVVDLAMEVGDVDRCIEQARRQGARILAEPHDETDEHGTVRSAAIATYGH
FT                   VRHTLIDRRRYTGPYLPGFRPVTTTAVRPDGAPRRLFQALDHAVGNVELGRMDEWVDFY
FT                   NRVMGFVNMAEFVGDDIATEYSALMSKVVANGNHRVKFPLNEPAAGKRKSQIDEYLEFH
FT                   AGPGCQHLALATGDILGTVDALRDRGVRFLDTPDAYYDDPELAARIGPVRVPVAELKKR
FT                   RILVDRDEDGYLLQIFTKPLGDRPTIFFEIIERHGSLGFGKGNFKALFESIEREQAARG
FT                   NL"
     atgaccctgt cgttcgagga cacccggcgc gcagcacccg atgaacccac cgacgaggcc        60
     ttgcgcgacc tggtcggcct ggtcgaccac gacgtgacca ccgacccgtt cccggtgctc       120
     ggcatggacg ccgtggtgtt cgtctgcggc aacgccaccc agtccgccca gtacttccag       180
     gcggtgtggg ggatggaccc gttcgcctac cgcggcccgg agaccggcca ccgcggcgac       240
     gtcgcctacg cgctcaaatc cgggtccgcc cgcttcgtgc tgaccggcgg cgtggccccg       300
     gacagcccgc tgctggacat ccaccgtgag cacggtgacg ccgtcgtcga cctggccatg       360
     gaggtcggtg acgtcgaccg gtgcatcgag caggcgcggc ggcagggcgc gcgcatcctg       420
     gccgaaccgc acgacgagac cgacgagcac ggcaccgtcc gcagcgccgc catcgccacc       480
     tacggccacg tccggcacac gctgatcgac cggcgccggt acaccggccc ctacctgccc       540
     ggcttccgcc ccgtcacgac caccgcggtc cggccggacg gcgccccgcg gcggctgttc       600
     caggccctgg accacgcggt cggcaacgtc gaactcggcc gcatggacga atgggtcgac       660
     ttctacaacc gcgtcatggg tttcgtgaac atggccgagt tcgtcggcga cgacatcgcc       720
     accgagtact cggcgctgat gagcaaggtc gtcgccaacg gcaaccaccg ggtgaagttc       780
     ccgctgaacg aaccggcggc cggcaagcgc aagtcgcaga tcgacgagta cctggagttc       840
     catgccggcc cgggatgcca gcacctggcg ctggccaccg gcgacatcct gggcacggtg       900
     gacgccctgc gggatcgggg cgtgcggttc ctggacactc cggacgccta ctacgacgac       960
     ccggagctgg cggcccggat cgggccggtg cgggtgccgg tcgccgaact caagaagcgc      1020
     cggatcctgg tcgaccggga cgaggacggc tacctgctgc agatcttcac caagccgctg      1080
     ggcgaccggc cgacgatctt cttcgagatc atcgagcggc acggctctct cggcttcgga      1140
     aagggcaact tcaaggcgct gttcgaatcg atcgagcggg agcaggcggc ccgcgggaac      1200
     ctgtga                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page