(data stored in ACNUC30630 zone)

EMBL: CP001737.PE518

CP001737.PE518       Location/Qualifiers
FT   CDS_pept        598840..599184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76956"
FT                   /db_xref="UniProtKB/TrEMBL:C8X787"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76956.1"
FT                   /translation="MVSDGQPRSHLLGTFARIVTEEMAGERKAASDPNWKGRLLSEVLE
FT                   ETGGQYEYVLDIPDRVMADLQRHVDLVDDPVARQVLETGRLVVPFENLNGLDPATTRVA
FT                   LGFGFGGHPA"
     atggtcagcg acggtcagcc ccgatcccac ctgctgggaa ccttcgccag gattgtgacc        60
     gaggagatgg ctggtgagcg gaaggccgcg agcgatccga actggaaggg ccggctgctc       120
     agcgaggtct tggaagagac cggaggccaa tatgagtatg tcttggacat cccagatcgc       180
     gtcatggctg acctgcaacg tcacgtcgac ttggtagacg acccggtagc ccgtcaggtc       240
     ctcgaaactg gcaggcttgt tgtcccgttc gagaacctga acggactcga tcccgcgacg       300
     acccgcgttg cgctcggctt cggcttcggc ggtcacccag cctaa                       345
//

If you have problems or comments...

PBIL Back to PBIL home page