(data stored in ACNUC30630 zone)

EMBL: CP001737.PE519

CP001737.PE519       Location/Qualifiers
FT   CDS_pept        complement(601016..603217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0541"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xac:XAC1623 chromosome segregation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76957"
FT                   /db_xref="UniProtKB/TrEMBL:C8X788"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76957.1"
FT                   /translation="MASERFKLALDQVGPDNWREFEVLAAEFLVTDYPSLRTMAASTGD
FT                   KGRDGELFSPSENSSSVAIQYSVAENWKDKISKTLKRLEETMPNLRTLIYVTNQRIGPS
FT                   ADELKRKIQEKGITVDVRDQSWFLERELTSPQRQVAAAELAERFVDPLLSARGVKQTVA
FT                   TVLDDSEAQVALLHLALDVQDKATDKGLTKTSFETLVIAALEGTTSDRTIGSDQIIQRV
FT                   CAMMPSGNPRQVQEQATSALRRLTSKGGPVHFHKSSDSYCLSHEKATQVRERMAEYVND
FT                   ETSLELQIKDLVNAAADGEIGAIEGEVFDACARNLRGAIEQLLLEKGEAFAGAVSSGRM
FT                   VQLDAEQVRAAVVSLVPTEFPVTVEQAVGIIVEVMQRPLGSTRRHLRRLADAYTLFAFL
FT                   RQVPDVQKTIVKLFDGGHIWLDTTVILPMLAETLILEPSERPFTVLLKAARESGIQLFV
FT                   TSGIVEEVERHINRSLTFARGTREKWRGSVPFLYGVFALSGRSRASFSGWTEEFRGDVR
FT                   PEDDVAEALWGLFRVGKRDLLQYSDAADLSLRGAVQEVWQEAHDRRRGTGANSDLDSMT
FT                   VNRLVAHDVENCVGVIQLRKGQPASPVGYRSWFLTMDRTAFSLVDELPRRIGPKAPGSP
FT                   IISPDFLSEFLRLGSLRTAIDQELRVNLPVVTDLGRFGNFPVNLVETAEEIRRESGEIS
FT                   ERLIRRRVRDTLDAERLRLGVKAYGGLSAVREEFASKFG"
     atggcttctg aacgcttcaa gctagcgctg gatcaagtgg gaccagacaa ttggcgcgaa        60
     ttcgaagttc ttgccgccga gtttcttgta actgactatc caagcctgcg cactatggcg       120
     gcaagcaccg gagacaaagg gcgtgacgga gagctctttt caccctcaga aaactcttcg       180
     agcgtggcca ttcagtactc agtcgccgag aactggaagg acaaaatatc taagaccctg       240
     aagcgactcg aagaaaccat gcctaacctc agaactctga tatacgtaac taatcaacgc       300
     attggaccgt cggcggacga gcttaagagg aagattcagg aaaaaggaat tacggtcgac       360
     gtgagggacc aaagttggtt tctcgagcgc gagctgacgt cacctcaacg gcaggttgcg       420
     gccgccgaac tggctgaacg attcgtggat ccgcttctgt cagcccgggg agtcaagcaa       480
     acagtcgcca ccgtcctgga cgactcagaa gcgcaggttg cgcttctaca cttggcattg       540
     gacgtccaag acaaagcgac cgacaagggc ttgacaaaga cgtcgttcga gaccttggtg       600
     atcgcagcac ttgaaggcac gacttcggac cgaaccatcg gttcggacca gatcattcaa       660
     cgagtttgtg ccatgatgcc ctctggcaat ccgcgccagg ttcaggaaca agcgacaagc       720
     gctctgaggc gattgacaag caagggcggt cccgtccact tccataagtc gtccgactct       780
     tattgcctct cgcacgaaaa ggctacccag gtccgcgaac gaatggccga gtacgtcaac       840
     gatgagacgt cactcgaact ccagatcaaa gacttggtca atgcagcagc tgatggcgag       900
     attggcgcaa tcgaaggaga agtcttcgat gcgtgcgccc gaaatctccg aggcgccata       960
     gagcagctgc tactggaaaa aggggaggcc tttgcgggag ccgtctcatc ggggcgaatg      1020
     gtacaactgg acgcggagca ggttcgcgcc gccgtggtgt cgttggtgcc cacagaattc      1080
     cccgttacgg tagagcaggc agttggcatc attgtggaag tgatgcaacg accgctgggc      1140
     tcaactcgtc gtcacctccg ccgactagcc gacgcttaca cacttttcgc cttcctgcgc      1200
     caggtccccg acgtgcagaa gactattgtg aagctattcg acggaggaca tatctggcta      1260
     gacaccacag tgattctccc tatgcttgcc gagacgctaa tcttggaacc cagtgaacgg      1320
     ccatttacgg tcctccttaa ggccgctcgc gaatcgggta tccaattgtt cgtcacaagc      1380
     ggaatcgtcg aagaagtaga gcgacacatc aaccggtccc tgacctttgc gcgaggaaca      1440
     cgcgaaaaat ggcgcggatc ggtgccattc ttgtatggcg tatttgctct gtcggggagg      1500
     tctcgtgcaa gtttctcggg gtggacggaa gagttccggg gggacgttcg ccccgaggac      1560
     gacgtcgcag aggcgctttg gggtctcttc agggtaggaa agcgtgacct cctgcagtat      1620
     tctgatgcag cagatttgag tctcaggggc gctgttcagg aagtgtggca agaagcgcac      1680
     gaccgaagga gagggacggg cgccaattcc gatctagatt cgatgacggt aaacagactt      1740
     gttgcacacg atgttgagaa ctgcgtagga gtaattcagc tccgaaaagg ccagcccgcc      1800
     tcgcccgtcg gatataggtc ttggttctta acgatggatc ggactgcatt ttctctggtt      1860
     gacgaacttc cgcggcggat cgggccgaaa gcgccaggct ccccgatcat cagtccggac      1920
     tttctctccg agttcctccg cctaggctca ttgcgtacgg caatcgacca ggaattgcgc      1980
     gtgaacctgc cagtcgttac cgacctgggg cggtttggca acttcccggt caacctggtc      2040
     gagacggctg aggagatccg gcgcgagagt ggggagattt ctgagcgttt gatcagaaga      2100
     agggtacggg acacacttga tgcggagcgg cttcggcttg gcgtgaaggc atacggtggc      2160
     ctttccgctg tgcgcgagga gtttgcttcg aagttcgggt ag                         2202
//

If you have problems or comments...

PBIL Back to PBIL home page