(data stored in ACNUC30630 zone)

EMBL: CP001737.PE520

CP001737.PE520       Location/Qualifiers
FT   CDS_pept        complement(603794..605113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0542"
FT                   /product="transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="PFAM: transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein; KEGG: pmy:Pmen_4491 transposase,
FT                   IS204/IS1001/IS1096/IS1165 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76958"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:C8X711"
FT                   /inference="protein motif:PFAM:PF01610"
FT                   /protein_id="ACV76958.1"
FT                   /translation="MDQSSSLLLDIDGLVVDQVVRDDVGRRVVHCSTDPQLAGWCPECG
FT                   EQSRSPKAWVTTRPRDVRLGEDRPILLWRKRKWRCQVDGCERKVFTECLPEQIPARARI
FT                   TTRARRLAAEAIGDHTRPVSGVAAEFGMDWRVAHDAFVAHAAQVLPEQPPPVTVLGVDE
FT                   TRRGKAHYETDPTTGAKTWVDRFDTGLVDLSGNGGLFAQVNGRTSKVLIEWLQAQDPDW
FT                   LANITHISMDTSATYARAARLALPDAVVVVDRFHLSALANKAVTDYRRELAWALRGRRG
FT                   RKSDPEWAQRNRLLRAAESLTDDELAKVQDAMRRADPSGGLEKCWQGKELLRKLLKLAG
FT                   TNPDRGRIFNALTAFYLHCADSGVAQLRRLAWTVHAWQNSIIAGLHTGISNGRTEGYNR
FT                   IVKHIGRIAFGFRNQDNQKRRVRYACTRKSRASTSHAKPC"
     atggaccaga gtagttcgct gctgttggac atcgacgggc tggtcgtcga ccaggtcgtc        60
     cgcgacgacg tcggccgacg ggtcgtgcac tgctcgaccg acccgcagct ggccggctgg       120
     tgcccggagt gcggtgagca gtcgaggtcg ccgaaggcgt gggtgacgac ccgcccgcgg       180
     gacgtccggc tgggcgagga tcggccgatc ctgttgtggc gcaaacgcaa atggcgctgc       240
     caggtcgacg gctgcgagcg gaaggtgttc accgagtgcc tgcccgagca gatccccgcc       300
     cgggcccgga tcaccacccg ggcccgccga ctggcggccg aggcgatcgg cgaccacacc       360
     cggccggtgt ccggtgtggc ggccgaattc ggcatggact ggcgcgttgc gcacgacgcg       420
     ttcgtcgcgc acgccgcgca ggtgttgccc gagcagccgc cgccggtgac cgtgctgggc       480
     gtcgacgaga cccgccgcgg caaggcccac tacgagaccg accccaccac cggggcgaag       540
     acctgggtgg accgcttcga caccggcctg gtcgatctga gcggcaacgg cgggctgttc       600
     gcgcaggtca acggccgcac cagcaaggtc ctcatcgagt ggctgcaggc gcaggacccg       660
     gactggctcg ccaacatcac ccacatctcg atggacacca gcgcgaccta cgcccgggcc       720
     gcccggctgg ccctgcccga tgctgtcgtg gtcgtggacc ggttccatct gtccgccctg       780
     gccaacaagg cggtcaccga ctaccggcgg gagttggcct gggcgctgcg tggccggcgg       840
     ggccgcaaga gcgacccgga gtgggcgcaa cggaaccggc tgctgcgggc cgcggagtcc       900
     ctgaccgacg acgagctggc caaggtgcag gatgcgatgc gtcgggcgga cccgtccggc       960
     ggccttgaga agtgctggca gggcaaggaa ctgctccgca agctgctcaa gctggctggc      1020
     acgaacccgg accgcggacg gatcttcaac gcgctgaccg cgttctatct gcattgcgcc      1080
     gactccgggg tcgcgcagct gcggcggctg gcgtggacgg tgcacgcctg gcagaactcg      1140
     atcatcgccg ggctgcacac cgggatcagc aacggccgca ccgagggcta caaccggatc      1200
     gtcaaacaca tcggccggat cgccttcggc ttccgcaacc aggacaacca gaagcgccgg      1260
     gtacgctacg cctgcacccg gaaatcccgg gcgtcaacca gccacgcgaa gccctgctaa      1320
//

If you have problems or comments...

PBIL Back to PBIL home page