(data stored in ACNUC30630 zone)

EMBL: CP001737.PE523

CP001737.PE523       Location/Qualifiers
FT   CDS_pept        complement(606718..607866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0545"
FT                   /product="histidine kinase"
FT                   /note="PFAM: histidine kinase dimerisation and
FT                   phosphoacceptor region; ATP-binding region ATPase domain
FT                   protein; KEGG: scl:sce5432 putative two-component system
FT                   sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76961"
FT                   /db_xref="GOA:C8X792"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8X792"
FT                   /inference="protein motif:PFAM:PF07730"
FT                   /protein_id="ACV76961.1"
FT                   /translation="MATSALRSLWAEPRPTNAPDLGPRDWALVAALTCWSVIEAVLRQD
FT                   LASGPLLLLAALAVIGPLLWRRTHPLLAVVVCFGTLTIVDLVRILTGPHGALLNSTAAT
FT                   LILTYALFRWGSGREAVCGLGIVLLWLPITIHGADPTSLAEAVAGYAFFLFAAALGAAI
FT                   RYRTKIRIREIDHAKAREREQLARELHDTVAHHVSGIVIQAQAGRAVAASHPEQAVEAL
FT                   AVIEDAATRTLTELRAIVGVLRASQDTELAPQPGVAQVEQLATDGLTRPCVEVTLSGEF
FT                   DNLSPAVGAAIYRLAQESITNARRHARHATQVSVAVHGDADQVRLTVDDDGSAAGGRGP
FT                   AGYGLVGMRERALLLGGTFDAGPAAERGWRVEAVLPRTGRPR"
     gtggccacca gcgcactccg ctcgctgtgg gccgaacctc gacccacgaa tgccccggac        60
     ctaggcccgc gggactgggc gttggtcgcg gcactgacct gctggtcggt gatcgaggcg       120
     gtgcttcgtc aggacctggc gtcgggcccg ctgctgctgc tcgctgcgct cgcggtcatc       180
     ggccccctgc tgtggcggcg cactcacccg cttctcgcag tggtggtctg tttcggcaca       240
     ttgacgatcg tcgacctggt cagaatcctc accgggccgc acggcgctct gctgaacagc       300
     accgctgcga cgctgatcct gacctacgcc ctgttccggt ggggctcagg ccgggaagcg       360
     gtctgcgggc tcggcatcgt cctgctctgg ctgcccatca ccatccacgg cgccgacccc       420
     accagcctgg ccgaggcggt cgcgggatac gcgtttttcc tgttcgcggc tgcgctgggc       480
     gccgcgatcc gctatcgcac gaagatccgc atccgcgaga tcgaccacgc caaggcccgg       540
     gaacgtgaac agctcgctcg cgaacttcac gacacggtcg cccaccacgt ctcggggatc       600
     gtcatccagg cccaagccgg acgtgccgtc gcggcgtcgc accccgagca ggccgtcgag       660
     gccctggccg tcatcgagga cgcagcgacc cgaaccctca ccgagttgcg ggccatcgtc       720
     ggcgtgctcc gcgcctcgca ggacaccgag ttggcgccgc agcccggcgt ggcgcaggtc       780
     gagcagctcg ccaccgatgg cctgacgcgt ccctgcgtcg aggtgacgct ctccggcgag       840
     ttcgacaacc tcagcccggc agtcggggcc gcgatctacc ggctggccca ggagtccatc       900
     accaacgctc gacggcatgc ccgccacgcg acccaggtct ccgtcgccgt ccacggcgac       960
     gccgaccagg tacggctgac cgtcgacgac gacggctccg ccgccggcgg acgcggccca      1020
     gcaggctacg gcctggtggg catgcgggaa cgcgctctac tgctcggcgg caccttcgac      1080
     gcgggccccg ccgccgagcg gggttggcgg gtggaggcgg tcctgccccg aaccgggagg      1140
     ccgcgatga                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page