(data stored in ACNUC30630 zone)

EMBL: CP001737.PE528

CP001737.PE528       Location/Qualifiers
FT   CDS_pept        complement(609975..611918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0550"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; SMART: von
FT                   Willebrand factor type A; KEGG: ade:Adeh_2705 response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76966"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C8X797"
FT                   /inference="protein motif:PFAM:PF00092"
FT                   /protein_id="ACV76966.1"
FT                   /translation="MTARRRYSYRAYDGGPDPLAPPFDLREAIDRIGADVLDGSSPRQA
FT                   LQELLRRGLGERRGLDELTRQLWQRRRELQRNNRLDGTLQQVRELLDRALTAERKALAR
FT                   QDSDDARFGELQLDALPTDAAGAVRELENYDWQSPDGRAAYEQIRDLLGREMLDQRFAG
FT                   MKQALENATSQDVQAIRDMLADLNELLSAHARLEDTTERFGEFMNRHGHFFPEQPRTTD
FT                   ELIDVLAARSAAAQRMMNSLSADQRAELAALTEQAFGDPRLAQSLAQLDAMLQQLRPGQ
FT                   DWDGSGRFRGDNPMGMGEATRALEELGRLESLGEQLAQGYPGASLDDIDLDLLQDVLGE
FT                   QARVDARALAELERELREQGLLERAADGSLQLSPKALRRLGQTALRDIADQVAGRSGER
FT                   ETRRSGPAGEASGATRPWAFGDTEPWHVPRTLLNAQVRRAGGDPRVLDVTDVEVVETER
FT                   RARAAVALCVDTSWSMVQEGRWVPMKRTALALHQLISTRFRGDDLALITFGRHAEKVEL
FT                   GQLVGLEGAYVQGTNLHHALLLAGAHLRRHPDATPVVLVVTDGEPTAHLEPDGSPHFSY
FT                   PPDPETVHATVGELDRLTGLRAAVTFFILGDDPRLALFTDKLARRCGGRVVAPDLDGLG
FT                   ASVVADYLRHRR"
     atgaccgcac gtcgccggta ttcctaccgg gcctacgacg gcggcccgga cccgctcgcg        60
     ccgccgttcg acctgcgcga ggcaatcgac cggatcggcg ccgacgtgct ggacggcagc       120
     tctccgcggc aggccctgca ggaactgctg cgccgcgggc tgggcgaacg gcgcgggctg       180
     gacgagctga cccgccagtt gtggcagcgg cggcgggaac tgcaacgcaa caaccggctc       240
     gacggcaccc tgcagcaggt ccgggaactg ctcgaccggg cgctgaccgc cgagcgaaag       300
     gcgctggccc gccaggattc ggacgacgcg cggttcggcg agctgcagct ggacgcgttg       360
     cccaccgacg ccgccggcgc cgtccgcgag ctggagaatt acgactggca gtcccccgac       420
     gggcgggccg cctacgagca gatccgcgac ctgctggggc gggagatgct cgaccagcgg       480
     ttcgccggca tgaaacaggc gctggagaac gcgacatcgc aggacgtcca agccatccgg       540
     gacatgctgg ccgacctcaa cgagttgctg tcggcgcacg cccggctgga ggacaccacc       600
     gagcggttcg gcgagttcat gaaccggcac ggccacttct tccccgagca accgcgcacc       660
     accgacgagc tgatcgacgt gctcgcggcc agatccgcgg cggcgcaacg gatgatgaac       720
     tcactgtcgg ccgaccagcg ggccgagctg gccgcgctga ccgagcaggc gttcggcgat       780
     ccccggctgg cgcagtcgct ggcccagctg gacgcgatgc tgcagcagtt acggcccggc       840
     caggactggg acggctccgg caggttccgc ggcgacaacc cgatgggcat gggcgaggcc       900
     acccgagccc tggaggagct gggccggctg gagtcgctgg gcgagcaact cgcccagggc       960
     tacccgggcg ccagcctgga cgacatcgac ctggacctgc tgcaggacgt gctgggcgag      1020
     caggcccggg tggacgcccg ggcgctggcc gagctggaac gtgaactgcg cgaacagggc      1080
     ctgctcgagc gggccgccga cggctccctg cagctgtccc ccaaggcact gcgccggttg      1140
     ggccagaccg cgttgcgcga catcgcggac caggtcgccg gccgctccgg ggagcgggag      1200
     acccgtcggt ccgggccggc cggcgaggcc tccggggcga cccggccgtg ggccttcggc      1260
     gacaccgaac cgtggcacgt gccgcggacc ctgctcaacg cccaggtgcg gcgggccggc      1320
     ggcgatcccc gagtgctgga cgtcaccgat gtcgaggtcg tggagaccga gcgacgggcc      1380
     cgcgccgcgg tggcgctgtg cgtggatacc tcctggtcga tggtgcagga gggccggtgg      1440
     gtgccgatga aacgcaccgc cctggccctg caccagctga tctccacccg gttccgcggg      1500
     gacgacctgg ccctgatcac cttcggccgg cacgccgaga aggtcgagct ggggcagctg      1560
     gtcgggctgg agggtgccta cgtgcagggc accaacctgc accacgcgct gctgctggcc      1620
     ggcgcgcacc tgcggcggca ccccgatgcc accccggtgg tcctggtggt gaccgacggc      1680
     gaacccaccg cgcacctgga acccgatggc tcgccgcact tctcgtaccc gccggatccg      1740
     gagacggtgc atgcgacggt gggcgaactg gaccggctga ccgggctgcg cgccgccgtc      1800
     accttcttca tcctcggtga cgacccgcgg ttggccctgt tcaccgacaa actggctcgc      1860
     cgctgcggcg gccgggtggt cgcccccgac ctggacgggc tcggggcctc ggtggtcgcc      1920
     gactacttgc ggcatcggcg atga                                             1944
//

If you have problems or comments...

PBIL Back to PBIL home page