(data stored in ACNUC30630 zone)

EMBL: CP001737.PE531

CP001737.PE531       Location/Qualifiers
FT   CDS_pept        complement(613886..614893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0553"
FT                   /product="DNA primase small subunit"
FT                   /note="PFAM: DNA primase small subunit; KEGG:
FT                   afw:Anae109_0939 DNA ligase D"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76969"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7A0"
FT                   /inference="protein motif:PFAM:PF01896"
FT                   /protein_id="ACV76969.1"
FT                   /translation="MAPDSARPRRRPRPAETRDGVELTNLDVPLADGPETKRELVDYLD
FT                   AVADRLIPVLADRALSVVRVRPGQPPFMQKNLPTYTPDWVATTTVWAHASHREIRYALG
FT                   NDRRTLLWFANQRAVEYHPALIPVGRTGPTHLILDLDPPPGAGFDVVVATAHLVRRTLD
FT                   ELGLAGAVKTSGSKGVHIFVPLTDDVEVEESAAATRAIAVRAAQLDPQVATTAYIVEDR
FT                   AGKVFIDATRSGGATVVAAYSPRLRPGLPVSFPVSWAELDRCHPSDFTIGNAAARLGDA
FT                   DPWRASMPPPQRLPAELVEHGRTIPVARVAAMHEGKRRARARRAATPTPDAGPS"
     atggctccgg acagcgcccg tccccgacga cgaccgcgcc cggccgagac ccgcgacggg        60
     gtcgagctga ccaacctgga cgtgccgctg gccgacggcc cggagaccaa acgggaactg       120
     gtcgactacc tggacgcggt ggccgaccgg ctgatcccgg tgctggccga ccgcgcgctg       180
     tcggtggtgc gggtacggcc cgggcagcca ccgttcatgc agaagaacct gccgacgtac       240
     accccggact gggtcgccac caccaccgtc tgggcgcacg cctcgcaccg ggagatccgc       300
     tacgccctgg gcaacgaccg ccggacgctg ctgtggttcg ccaaccaacg ggcggtcgag       360
     taccacccgg cgctcatccc ggtcggccgg accggcccga cccacctgat cctggacctg       420
     gacccgccgc ccggcgcggg gttcgacgtg gtggtggcca ccgcgcacct ggtgcggcgc       480
     accctggacg agctggggct ggccggcgcg gtgaagacca gcgggtccaa gggcgtgcac       540
     atcttcgtgc ccttgaccga cgacgtcgag gtcgaggagt ccgcggcggc cacccgggcg       600
     atcgccgtgc gggccgctca gttggacccg caggtcgcca cgaccgcgta catcgtcgag       660
     gaccgggcgg gcaaggtgtt catcgacgcc acccgctcgg gcggggcgac cgtggtcgcc       720
     gcctacagcc cgcggctgcg gccgggcctg ccggtctcgt ttcccgtgtc gtgggccgaa       780
     ctggaccgct gccatccgtc ggacttcacc atcggcaacg cggcggcccg gctcggcgac       840
     gccgatccgt ggcgggcctc gatgccgccg ccgcagcggt taccggccga gctggtcgag       900
     cacggccgga cgatcccggt ggcccgggtg gcggccatgc acgagggcaa acgccgggcg       960
     cgggcccgcc gcgcggcaac cccgaccccc gacgccggcc cctcctaa                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page