(data stored in ACNUC30630 zone)

EMBL: CP001737.PE54

CP001737.PE54        Location/Qualifiers
FT   CDS_pept        63184..64722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0054"
FT                   /product="PTS system, mannitol-specific IIC subunit"
FT                   /note="TIGRFAM: PTS system, mannitol-specific IIC subunit;
FT                   PFAM: phosphotransferase system lactose/cellobiose-
FT                   specific IIB subunit; phosphotransferase system EIIC; KEGG:
FT                   ppr:PBPRB0363 putative mannitol-specific IIABC component,
FT                   PTS system"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76492"
FT                   /db_xref="GOA:C8XI01"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR029503"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:C8XI01"
FT                   /inference="protein motif:TFAM:TIGR00851"
FT                   /protein_id="ACV76492.1"
FT                   /translation="MTADASAAGTTSKTSSTRVAVQKFGTFLSGMIMPNIAAFIAWGLI
FT                   TALFIEKGPFPIAVIGGFGVDDAGDPNPGLVGPMVRYMLPILIAAQGGRMIYGVRGAVV
FT                   AVVATMGVIMCTPQPMFLGAMVMGPLAAWLMKKLDSVWDGKIKPGFEMLVNNFSAGFLS
FT                   AGLAIASFYVFGPIIEGLSSALGTGVDWLISHSLLPLASLIIEPAKVLFLNNAINHGVL
FT                   TPLGINQSAETGQSILFLLEANPGPGVGLLIAYSIFGTGLAKSTAPAAAIIQFFGGIHE
FT                   IYFPYVLMKPLTLIATIAGGMVGILTLTIFNAGLRAPAAPGSIIAVLIQTPGSSLVGVL
FT                   LSVTLAAVTSFVIASIILKASKKTEESGDLAQATAKMEGMKGKKSAVSGVLTDIEAQKE
FT                   EADEAREAATRSAPIHKIVFACDAGMGSSAMGASVLRNKIKKAGFADITVVNVAIANLV
FT                   DDVDLIVTHQDLTARARDKAPHAQHVSVANFMNSPKYDEIVDELHVTNPQGSSA"
     gtgacagctg acgcgagcgc agccggaacc accagcaaga cgtcgagtac ccgagtagcg        60
     gtccagaagt tcggcacgtt cctgtccggg atgatcatgc ccaatatcgc ggcgttcatc       120
     gcgtggggtt tgatcactgc tctgttcatc gagaaggggc cgttcccgat cgcggtgatc       180
     ggcgggttcg gggtggacga cgcgggggat ccgaatccgg ggttggtcgg gccgatggtc       240
     cggtacatgt tgccgatcct gatcgcggcg cagggcggcc ggatgatcta cggggtgcgg       300
     ggcgcggtgg tcgcggtcgt cgcgacgatg ggcgtgatca tgtgcacgcc gcagccgatg       360
     ttcctcggcg cgatggtgat gggcccgttg gcggcctggt tgatgaagaa gttggactcg       420
     gtctgggacg gcaagatcaa gcccggtttc gagatgctgg tcaacaactt ctccgcgggt       480
     ttcctgtccg ccggtttggc catcgccagc ttctacgtgt tcgggccgat catcgagggt       540
     ctgtcctcgg cgttgggtac cggggtggac tggctgatct cgcacagctt gttgccgctg       600
     gccagtttga tcatcgagcc ggccaaggtg ttgttcctga acaacgcgat caaccatggg       660
     gtgttgaccc cgctggggat caaccagtcg gccgagaccg ggcagtcgat cctgttcctg       720
     ctggaggcca accccggtcc gggtgtcggt ctgctgatcg cgtactcgat cttcgggacc       780
     ggtctggcca agagcaccgc cccggccgcg gcgatcatcc agttcttcgg cgggatccac       840
     gagatctact tcccgtacgt gctgatgaag ccgctgaccc tgatcgcgac gatcgccggc       900
     ggcatggtcg gcatcttgac cctgaccatc ttcaacgccg gtctgcgggc gccggccgcg       960
     cccgggtcga tcatcgcggt gttgatccag acaccgggca gcagcctggt cggggtgttg      1020
     ttgtcggtga cgttggccgc ggtgaccagt ttcgtgatcg cctcgatcat cctcaaggcc      1080
     agtaagaaga ccgaggagag tggtgatctc gcgcaggcca cggccaagat ggaagggatg      1140
     aagggcaaga agagcgctgt ttccggggtg ctcaccgaca tcgaggcgca gaaggaggag      1200
     gccgacgagg cccgcgaggc cgcgacccgg tcggcgccga tccacaagat cgtgttcgcc      1260
     tgcgacgccg ggatgggttc gtcggcgatg ggtgcctcgg tgctgcggaa caagatcaag      1320
     aaggctgggt tcgccgacat caccgtggtc aacgtggcca tcgcgaacct ggtcgacgat      1380
     gtcgatctga tcgtgaccca tcaggacctg accgcccggg ctcgggacaa ggccccccac      1440
     gcccaacacg tctcggtggc caacttcatg aacagcccca agtacgacga gatcgtcgac      1500
     gagctgcacg tcaccaaccc gcagggcagt agcgcctga                             1539
//

If you have problems or comments...

PBIL Back to PBIL home page