(data stored in ACNUC30630 zone)

EMBL: CP001737.PE542

CP001737.PE542       Location/Qualifiers
FT   CDS_pept        complement(625592..625939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76980"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7B1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76980.1"
FT                   /translation="MVQLADARKSADQRRSHDLEIEGASPRYKPGEFAAMEIALALTAS
FT                   TPTEHQQIARARRLQAKAPDAWDAWIAGDINEAKAHQISHALRKLERADSKRMLNLDVV
FT                   VAARPLTDPAG"
     atggtgcaac tcgccgacgc ccgcaagtcg gccgatcagc ggcggagtca cgacctggag        60
     atcgaaggcg ccagcccccg atacaagccc ggcgagttcg ccgcaatgga gatcgcgctg       120
     gctctgaccg cgtcaacccc cacggagcat cagcagatcg cccgggcccg gcgcctgcag       180
     gccaaggcac cggacgcgtg ggacgcctgg atcgccgggg acatcaacga ggccaaggcc       240
     caccagatca gtcacgccct gcgcaagctg gaacgggccg actcgaaacg gatgctgaac       300
     ctggacgtgg tcgtcgctgc ccgcccgctc accgacccgg ccggatag                    348
//

If you have problems or comments...

PBIL Back to PBIL home page