(data stored in ACNUC30630 zone)

EMBL: CP001737.PE550

CP001737.PE550       Location/Qualifiers
FT   CDS_pept        complement(633694..634437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76988"
FT                   /db_xref="GOA:C8X7B9"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7B9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76988.1"
FT                   /translation="MSQWWYDNIVEPAKLPLLLCLLAFVVTFLATRVVTRMIRAGIGPF
FT                   RNNVSAGGLHIHHAVPGIILLILGALMALRLPESPWFEIAAVLVGVGTSLVLDEFALIL
FT                   HLDDVYWANEGRISVEMTGLAAACIGLALLGFSPLGVDDLTVGDIRIRITLLVGALIHG
FT                   ALLLVCVLKGKYRSALIGCFVPLVAWYSAVRLARPGTWWARHRYRGRTLERCRRREAAF
FT                   DEKWDPRWQWLSDVIAGAPTEPPRE"
     atgagccagt ggtggtacga caacatcgtc gagccggcca agctcccgct gctgctgtgc        60
     ctgctcgcct tcgtcgtgac cttcctggcc acccgggtgg tcacccggat gatccgggcc       120
     ggcatcggcc cgttccgcaa caacgtctcg gccggcggcc tgcacatcca tcacgccgtc       180
     cccgggatca tcctgctcat cctgggcgcg ttgatggcgc tgcggctgcc cgaatcgccc       240
     tggttcgaga tcgccgccgt gctggtcggg gtgggcacct cgctggtgct cgacgagttc       300
     gcgctgatcc tgcacctgga cgacgtctac tgggccaacg agggccggat ctcggtcgag       360
     atgaccggcc tggccgcggc gtgcatcggc ctggccctgc tgggcttcag cccgttgggg       420
     gtcgacgacc tgaccgtcgg cgacatccgg atccggatca ccctgctggt cggcgcgctc       480
     atccacggcg ccctgctgct ggtctgcgtc ctcaagggca agtaccgctc ggcactgatc       540
     gggtgtttcg ttccgctcgt cgcctggtac tcggcggtgc ggttggcccg tccgggcacc       600
     tggtgggccc ggcaccggta tcgcggtcgc acgctcgagc ggtgccggcg gcgggaggcg       660
     gccttcgacg agaagtggga tccccgatgg cagtggctct ccgacgtgat cgccggggcg       720
     ccgaccgagc cgccccgcga gtga                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page