(data stored in ACNUC30630 zone)

EMBL: CP001737.PE568

CP001737.PE568       Location/Qualifiers
FT   CDS_pept        651208..651651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0591"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: hch:HCH_04806
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACV77006"
FT                   /db_xref="GOA:C8X830"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:C8X830"
FT                   /inference="protein motif:PFAM:PF07681"
FT                   /protein_id="ACV77006.1"
FT                   /translation="MATMTRSSDTSTSARSAVATATGLVVLRVVLGAVMIVHGWQKFFV
FT                   DGISGVSGFFGQMGVPLAGFSAAAVATVELVGGVLLILGLGTRVVGALYALCMVGAIVF
FT                   VHGANGFLAAAGGYEFVLVLAAVSAALALLGGGRYALDALIKR"
     atggccacca tgacccgcag ttccgatacc tcgacgtccg cccgcagcgc cgtcgccacc        60
     gccactgggt tggtggtgct gcgcgtggtc ctgggcgcgg tgatgatcgt gcacggctgg       120
     cagaagttct tcgtggacgg catttccggc gtcagcgggt tcttcggcca gatgggcgtc       180
     ccgctggctg gattcagtgc ggcggcggtg gccacggtcg agctcgtcgg cggcgtcctg       240
     ctgatcctgg gtctgggcac ccgggtggtc ggcgcgctct acgccctgtg catggtcggc       300
     gcgatcgtgt tcgtgcacgg ggccaacggg ttcctggccg ccgccggtgg gtacgagttc       360
     gtcctcgtgc tggccgccgt ctcggccgcg ctggccctgc tcggcggcgg tcgctacgcg       420
     ctggacgcgc tgatcaagcg ctga                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page