(data stored in ACNUC30630 zone)

EMBL: CP001737.PE572

CP001737.PE572       Location/Qualifiers
FT   CDS_pept        complement(655642..656544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0595"
FT                   /product="3-methyladenine DNA glycosylase/8-oxoguanine DNA
FT                   glycosylase-like protein"
FT                   /note="KEGG: afr:AFE_1848 base excision repair protein,
FT                   HhH-GPD family"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACV77010"
FT                   /db_xref="GOA:C8X834"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:C8X834"
FT                   /inference="protein motif:COG:COG0122"
FT                   /protein_id="ACV77010.1"
FT                   /translation="MTSFSITPTTPFRLQESAEFGFGGRAADSFDGVMRMAFCLDGYAD
FT                   QVGVAVRQDADGTVHGRVDGVGPDRVDAVRAQVARVLSLDQDGGEFLDVGHRDPVIGRL
FT                   QEVAPGLLPPLFYSPYEAALWSVLSARRPAQQMAQVRTQLSERHGRTFELAGRRLAAMP
FT                   TPEQLLRVTEFPGLTPEKIHRMHGIARQALTGTLDVARLRHIGPTACQDDMQRLKGIGP
FT                   FYASLITIRAVGFTDVLPVDEPMLLELVGLHYRVDGPVTRAAFEQIAEPWRPYRTWTSV
FT                   LIRAASSRIGVVGSRRRAG"
     atgaccagtt tctcgatcac cccgaccacc ccgttccggc tccaggaatc ggccgagttc        60
     gggttcggcg ggcgcgcggc cgactcgttc gacggcgtga tgcggatggc gttctgcctg       120
     gacggctatg ccgaccaggt gggcgttgcg gtgcggcagg atgccgacgg caccgtgcac       180
     ggcagggtag acggggtcgg cccggatcgg gtcgacgcgg tgcgggccca ggtcgcgcgg       240
     gtgctgtcgc tggatcagga cggcggtgaa ttcctcgacg tcggccaccg ggacccggtg       300
     atcggtcggc tgcaggaggt cgcccccggg ctgctgccgc cgctgttcta ttcgccctac       360
     gaagcggccc tgtggtcggt gctgtccgcc cggcggccgg cgcagcagat ggcccaggtc       420
     cgcacccagc tgtccgaacg gcacggccgg accttcgagc tggccggccg gcggctggcg       480
     gcgatgccga cgcccgagca gctgctgcgg gtgaccgagt tccccgggtt gaccccggag       540
     aagatccacc ggatgcacgg catcgcccgg caggcgctga ccggcactct ggacgtggcc       600
     cggctacggc acatcgggcc gaccgcctgc caggacgata tgcagcggct caagggaatc       660
     ggccccttct acgcctcgct gatcaccatc cgggcggtcg gcttcaccga cgtgctgccg       720
     gtcgacgagc cgatgctgct cgagctggtc gggctgcact accgggtgga cggtccggtc       780
     acccgggccg cgttcgagca gatcgccgag ccgtggcggc cgtaccgcac ctggacatcg       840
     gtgctgatcc gggcggcgtc gtcgcggatc ggggtggtcg gcagccgccg ccgggccggc       900
     tga                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page