(data stored in ACNUC30630 zone)

EMBL: CP001737.PE575

CP001737.PE575       Location/Qualifiers
FT   CDS_pept        658949..659233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0598"
FT                   /product="FHA domain-containing protein"
FT                   /note="KEGG: ade:Adeh_3741 FHA domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACV77013"
FT                   /db_xref="UniProtKB/TrEMBL:C8X837"
FT                   /inference="similar to AA sequence:KEGG:Adeh_3741"
FT                   /protein_id="ACV77013.1"
FT                   /translation="MTDQDRTPDASADVRERAGATEDYGGVPISDAELAQVWMSPDAAE
FT                   AAGAADPDNAESAGAPESEPPADESAAAAQGAVTRPEVPADDPAPAEPA"
     atgaccgatc aggaccgaac tcccgacgct tccgccgacg tccgcgagcg ggccggtgcg        60
     acggaggact acggcggggt gccgatcagc gacgcggaac tcgcgcaggt gtggatgagt       120
     cccgacgcgg cggaggccgc gggcgccgcc gacccggaca acgccgagtc cgcgggggcc       180
     ccggagtcgg agccacccgc ggacgagagc gccgctgcag cgcaaggcgc ggtcacccgg       240
     cccgaggtgc cggcggacga cccggcaccg gccgagccgg cgtga                       285
//

If you have problems or comments...

PBIL Back to PBIL home page