(data stored in ACNUC30630 zone)

EMBL: CP001737.PE580

CP001737.PE580       Location/Qualifiers
FT   CDS_pept        665682..667178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0603"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   afw:Anae109_0031 EmrB/QacA family drug resistance
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACV77018"
FT                   /db_xref="GOA:C8X842"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C8X842"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ACV77018.1"
FT                   /translation="MAAAPGAAAAPLVYRSARGKWVLAATVLGSGLAQLDGTVVNVALP
FT                   RIGEDLGGGLTALQWTLNAYTLTLSGLLLLGGSLGDRMGRRRIFILGVIWFTVASVGCA
FT                   FAPSTGLLIAMRALQGAGAALLTPGSVAILQASFRPDDRSTAVGAWSGLGGVATAIGPI
FT                   VGGLLVGVAPWGWRLVFLINLPIAAAVIVLSRRYIPESRDEQATGRVDVPGALLASFGL
FT                   GGLVFGLTEGPAGGWTPPVVAITVAGVLLLGLFLLVESRTAEPLLPLGLFADRQFSAAN
FT                   LVTFAVYAALAGALFLLPVQLQLVAGFSPVQAGAATLPITVMMLLLSARMGRLSARIGP
FT                   RLPMTVGPLVAATAMFWLSFVDAGATFLGAVVGPMLLFGLGLSFTVAPLTSTVLAAAPD
FT                   HQAGVASAINNDVARVAGLLAVAVLPALAGLSPAAYADPALMSGGFHRAVLIAGAVCAA
FT                   GGLLALVTIRNPVAGPEHEHADPALECAACPVLAPHIKPR"
     atggcggctg caccgggcgc cgcggccgca ccactggtgt accggtccgc gcggggcaag        60
     tgggtgctgg ccgcgaccgt gctgggcagc ggattggccc agctggacgg aaccgtcgtc       120
     aacgtggccc tgccccggat cggcgaggac ctgggcggcg ggctgaccgc cctgcaatgg       180
     acgctcaacg cctacacgct gaccctgtcc ggcctgctgt tgctgggtgg ctcgctcggc       240
     gaccggatgg gccggcgacg gatcttcatc ctgggcgtca tctggttcac cgtggcctcg       300
     gtgggttgcg cgttcgcgcc gagcaccggc ctgctgatcg cgatgcgcgc gctgcagggc       360
     gccggcgcgg ccctgctgac gccggggtcg gtggccatcc tgcaggcctc gttccggccg       420
     gacgaccgct cgaccgcggt cggcgcctgg tccgggctgg gcggggtggc caccgcgatc       480
     ggcccgatcg tcggtggcct gctggtcggc gtcgcgccgt ggggctggcg gctggtcttc       540
     ctgatcaacc tgccgatcgc ggccgccgtg atcgtgctgt cccgccgcta catccccgag       600
     tcccgggacg agcaggcgac cggacgggtg gacgtgcccg gcgcgctgct cgcctcgttc       660
     ggcctgggcg ggttggtgtt cgggctgacc gagggtccgg ccggcggctg gaccccgccg       720
     gtggtcgcga tcaccgtggc cggcgtgctg ctgcttggcc tgttcctgct ggtggagagc       780
     cggaccgcgg agccgctgct gccgttgggc ctgttcgccg accggcagtt cagcgccgcc       840
     aatctggtca ccttcgcggt gtacgccgcg ctggccgggg cgctgttcct gctgccggtg       900
     cagctgcaac tggtggccgg gttcagcccg gtgcaggcgg gtgcggccac cctgccgatc       960
     accgtgatga tgctgttgct gtcggcccgg atgggccggc tgtcggcccg gatcggcccg      1020
     cggctgccga tgacggtcgg cccgctggtg gccgccacgg cgatgttctg gctgtccttc      1080
     gtcgacgccg gcgccacctt cctgggcgcg gtggtcggcc cgatgctgct gttcgggctg      1140
     ggcctgtcgt tcacggtcgc gccgctgacc tcgaccgtgc tggccgcggc gcccgatcac      1200
     caggccgggg tggcctcggc gatcaacaac gacgtggccc gggtcgccgg actgctcgcg      1260
     gtggcggtgc tgcccgcgct ggccggcctg agcccggcgg cctacgccga cccggcgctg      1320
     atgtcgggag gctttcaccg ggccgtgctg atcgccggcg cggtgtgcgc ggccggcggc      1380
     ctgctggcct tggtgaccat ccgcaatccg gtggccggac cggagcacga gcatgccgac      1440
     ccggccctgg agtgtgccgc ctgcccggtg ctggccccgc acatcaagcc ccgctga         1497
//

If you have problems or comments...

PBIL Back to PBIL home page