(data stored in ACNUC30630 zone)

EMBL: CP001737.PE586

CP001737.PE586       Location/Qualifiers
FT   CDS_pept        complement(671350..672198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0609"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACV77024"
FT                   /db_xref="GOA:C8X848"
FT                   /db_xref="UniProtKB/TrEMBL:C8X848"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV77024.1"
FT                   /translation="MLVGLTLAVLASLGSGAGSAVEAIGVRRARHRATGQAEVGALLRE
FT                   PVYFAGLAVDLLGFAFTVLALQVLPLYLVQAIVASSVAVTALILAAMGRPLDRIGWIAL
FT                   GGSLCGLVLLGLSSQPHEVPPLAPGWYWLLLGLALPIAGLAAVATRLKGIVSVVLLAFG
FT                   AGLCFSLVAVAARSLDVPAPLWRAVIDPALWAIVVNGVLGTALFAMALQRGRVTVVAAV
FT                   SYTTSTVVPSVIGLVFLGDQVRSGFALVATARFLVAVSGAVALARFTEPLPASTPQAAT
FT                   A"
     atgcttgtcg gattgacgct ggcggtgctc gcctcgctgg gctccggggc cgggtcggcg        60
     gtcgaggcga tcggggtgcg ccgggcccgc caccgcgcca ccggccaggc ggaggttggc       120
     gcgctgctgc gcgagccggt ctacttcgcc gggctggccg tcgacctgct cgggttcgcc       180
     ttcaccgtgc tggccctgca ggtgctgccg ctgtatctgg tgcaggcgat cgtcgcctcc       240
     agcgtggccg tcaccgcgtt gatcctggcc gcgatggggc gcccgctgga tcgcatcggc       300
     tggatcgccc tcggcgggtc cctgtgcgga ctggtgctgc tgggtctgtc ctcccaaccc       360
     catgaggtcc ccccgctggc tccgggctgg tactggctgc tgctgggtct ggccctgccg       420
     atcgccggcc tggccgccgt cgccacccgg ctcaagggca tcgtgtcggt cgtcctgctc       480
     gccttcggcg ccggcctgtg cttcagcctc gtcgcggtcg ccgcccgcag cctggacgtc       540
     cccgcgccgc tctggcgggc ggtgatcgat ccggccctgt gggcgatcgt ggtcaacggt       600
     gtgctgggta ccgccctgtt cgcgatggcc ctgcaacgcg ggcgggtcac ggtcgtcgcc       660
     gcggtgtcct acacgaccag cacggtggtg ccctcggtga tcggtctggt cttcctcggc       720
     gatcaggttc gcagcggctt cgcgctggtg gccaccgcca ggttcctggt cgcggtcagc       780
     ggggcggtcg ccctggcccg attcaccgag ccgctcccgg cctcgacccc gcaggccgcg       840
     acggcctga                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page