(data stored in ACNUC30630 zone)

EMBL: CP001737.PE61

CP001737.PE61        Location/Qualifiers
FT   CDS_pept        complement(73877..74155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76499"
FT                   /db_xref="UniProtKB/TrEMBL:C8XI08"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76499.1"
FT                   /translation="MTALLLDIPTDLTNRPTETAADPRAGLPVATERVAGAAFCVDLDP
FT                   GLLSFTRRRIAEHFAVADDQVDVMITSGLLRLSQRLSRVLANRPATC"
     atgactgcac tcctgctcga tatcccgacc gacctgacga accgcccgac cgaaactgcc        60
     gccgacccgc gggccggcct gcccgtggcc accgaacgag tcgccggcgc cgccttctgc       120
     gtcgacctgg acccggggct gctcagcttc acccggcgcc ggatcgccga gcatttcgcg       180
     gtggccgacg accaggtcga cgtcatgatc acgtccggac tgctgcggct gagccagcgg       240
     ctgtcccggg tgctggccaa ccggcccgcc acttgttaa                              279
//

If you have problems or comments...

PBIL Back to PBIL home page