(data stored in ACNUC30630 zone)

EMBL: CP001737.PE68

CP001737.PE68        Location/Qualifiers
FT   CDS_pept        78092..78970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0069"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: rso:RS04802
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76506"
FT                   /db_xref="GOA:C8XIR9"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIR9"
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /protein_id="ACV76506.1"
FT                   /translation="MAPCTWHPDRLTPLSCSRCGRPACPECLTPASVGFHCRECVAQGQ
FT                   AATRPPRTIAGARLGDKPVVTFALIAVNLAFFLVTALQSRSAMDLSYSELYLRGGLIPA
FT                   EVASGEYWRLLTSGFLHGNLVHLATNMLSLYWLGIPLERILGRGRMLTIYLISLLGASV
FT                   SVLLFSAPVSLTIGASGAVYGLMGALLATFRRLRLDLRPLVVILALNVFITFSYPGLSW
FT                   QGHLGGFVAGAIVGAAMVFPPRASRAAWQWGISIGLVVVLAGLTVVAADRIGAYYCLYQ
FT                   VAGQVSCVPAH"
     atggcgccct gcacctggca cccggaccgg ttgacgccgc tgtcctgttc ccgctgcggg        60
     cggccggcgt gcccggagtg cctgacgccg gcctcggtgg gcttccattg ccgcgagtgc       120
     gtggcccagg ggcaggcggc cacccggccg ccgcgcacca tcgccggcgc ccggctgggc       180
     gacaagccgg tggtcacctt tgcgttgatc gcggtgaacc tggcgttctt cctggtcacc       240
     gcgctgcagt cgcgctcggc gatggatctg tcgtactccg agctgtacct gcggggtggc       300
     ctgatcccgg ccgaggtggc ctccggcgag tactggcgac tgctcacctc cggcttcctg       360
     cacggcaacc tggtccacct ggccacgaac atgctgtcgc tgtactggct ggggatcccg       420
     ttggagcgca tcctgggccg cggccggatg ctgacgatct atctgatcag cctgctgggc       480
     gcctcggtca gcgtgctgct gttcagtgcc ccggtcagcc tgaccatcgg cgcctccggg       540
     gcggtctacg gcctgatggg cgcgctgctg gccaccttcc gccggctgcg gctcgacctg       600
     cgcccgttgg tcgtgatcct ggccctgaac gtgttcatca ccttctccta cccgggcctg       660
     tcctggcagg ggcacctggg cggattcgtg gccggcgcga tcgtcggcgc ggcgatggtc       720
     ttcccgcccc gggcgagccg ggccgcctgg cagtggggga tcagcatcgg gctggtggtc       780
     gtgctcgcgg ggctcaccgt cgtggccgcc gaccggatcg gtgcctacta ctgcctgtac       840
     caggtggccg gacaggtcag ctgcgtgccg gcccactga                              879
//

If you have problems or comments...

PBIL Back to PBIL home page