(data stored in ACNUC30630 zone)

EMBL: CP001737.PE69

CP001737.PE69        Location/Qualifiers
FT   CDS_pept        complement(78948..79400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76507"
FT                   /db_xref="GOA:C8XIS0"
FT                   /db_xref="InterPro:IPR019692"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIS0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76507.1"
FT                   /translation="MSGDNDFPGPGARTWRPPSGILIGLMVVALAAAAAAVLDTDPMDR
FT                   LVYGLVGVVLLVLALVGRRRRLVAGPRGLLIAGAGGARIVPWSMVRSIECGRTRRMRTA
FT                   TLEIDLVDGELLLYGRLDLGAEPDAVLADLTGWFEGRDDLSGPARS"
     atgagtgggg acaacgactt ccccggcccg ggcgcccgaa cctggcgccc accgagcggg        60
     atcctcatcg gactgatggt ggtggcgctc gcggccgcgg ctgccgccgt tctggacacc       120
     gacccgatgg accggctggt ctacgggctg gtcggtgtgg tcctgctggt gctggcactt       180
     gtcggccggc gacggcggct ggtcgccgga ccgcgcggac tgttgatcgc tggggcgggc       240
     ggtgctcgca tcgtgccgtg gtccatggtc cggtccatcg agtgcgggcg cacccggcgg       300
     atgcggacgg ccacgctgga gatcgacctg gtcgacggcg agctgctgct ctacgggcgc       360
     ctcgacctcg gcgccgaacc cgacgccgtg ctggccgacc tcaccggctg gttcgagggc       420
     cgcgacgacc tcagtgggcc ggcacgcagc tga                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page