(data stored in ACNUC30630 zone)

EMBL: CP001737.PE7

CP001737.PE7         Location/Qualifiers
FT   CDS_pept        7832..9844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0007"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: gur:Gura_0004 DNA gyrase, B subunit; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA topoisomerase type IIA
FT                   subunit B region 2 domain protein; DNA gyrase subunit B
FT                   domain protein; TOPRIM domain protein; ATP-binding region
FT                   ATPase domain protein; SMART: DNA topoisomerase II;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76445"
FT                   /db_xref="GOA:C8XHV4"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHV4"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ACV76445.1"
FT                   /translation="MTTKKNEYGASSITVLEGLEAVRKRPGMYIGSTGERGLHHLVQEV
FT                   VDNSVDEAMAGYADRVEVILRADGGVTVIDNGRGIPVEMHPKEKKPTVEVVLTVLHAGG
FT                   KFDSDSYAVSGGLHGVGVSVVNALSTRLDVEIHRDGHAYRQSYRYAKPGPLETIGPSSR
FT                   TGSSVTFWPDGEIFETVEFKLETISRRLQEMAFLNKGLTITLRDERRTDVELEEIAESG
FT                   ANAVPVEAEPTTPAKAWKPLERTFHYPGGLVDYIKHLNHTKDPIHPSIVGFESKGETME
FT                   VEVAMQWNSSYNESVHSFANTINTHEGGTHEEGFRSSLTSVVNKYATDKKLLKEKDDKL
FT                   SGEDVREGLAAIISIRLREPQFEGQTKGKLGNTEAKSFVQKACNEWIADWFERNPSEAK
FT                   TIISKAVSSAQARAAARKARDLVRRKGALEIGGLPGKLADCRSTDPSKSELYIVEGDSA
FT                   GGSAKSGRDSMFQAILPIRGKIINVEKARIDRVLRNTEVQSLITALGTGIHDDFDLAKL
FT                   RYHKIVLMADADVDGQHIRTLLLTLLFRFMRPLVEAGHVYLAQPPLYKIKWSKGAHEFA
FT                   YSDRERDGLIAEGERAGRRMIKDEGVQRYKGLGEMNAKELWETTMDPANRLLLQVTLED
FT                   AATADELFSVLMGEDVEARRAFITRNAKDVRFLDL"
     gtgacgacga agaagaacga atacggtgcg tcttcgatca ccgtcctgga gggtctggaa        60
     gcggtccgta agcggcccgg catgtacatc gggtccaccg gcgagcgggg tctgcaccac       120
     ctggtccaag aggtcgtcga caactcggtc gacgaggcca tggccgggta cgccgaccgg       180
     gtcgaggtga tcctgcgggc cgacggcggc gtcaccgtca tcgacaacgg tcggggcatc       240
     ccggtggaga tgcaccccaa ggagaagaag ccgaccgtcg aggtcgtgct cacggtgctg       300
     cacgcgggcg gcaagttcga ctccgactcc tacgcggtct ccggcggcct gcacggcgtg       360
     ggtgtctcgg tggtcaacgc cctgtccacc cggctcgacg tggagatcca ccgagacggc       420
     cacgcctacc ggcagtccta ccggtacgcc aagcccggac cgctggagac gatcgggccg       480
     agctcgcgga ccgggtcgtc ggtcaccttc tggcccgacg gggagatctt cgagaccgtc       540
     gaattcaagc tggagaccat ctcccgccgg ttgcaggaga tggcgttcct gaacaagggc       600
     ctgaccatca ccctgcgcga cgagcgccgg accgacgtcg agctggagga gatcgccgag       660
     agcggtgcga atgccgttcc ggtcgaggcg gagccgacga cgccggccaa agcctggaag       720
     ccgctggagc ggaccttcca ctacccgggc ggcctggtcg actacatcaa gcacctcaat       780
     cacaccaagg acccgatcca cccgtcgatc gtcggattcg aatccaaggg cgagacgatg       840
     gaggtggagg tcgcgatgca gtggaactcc tcctacaacg agtccgtgca ctcctttgcc       900
     aacaccatca acacccacga gggcggcacc cacgaagagg gcttccgctc gtcgctgacc       960
     tcggtggtga acaagtacgc gaccgacaag aaactgctga aggaaaagga cgacaagctt      1020
     tccggcgagg acgtccgcga ggggctggcc gcgatcattt cgatccggct gcgcgaaccg      1080
     cagttcgagg gacagaccaa gggcaagctg ggcaacaccg aggccaagtc gttcgtccag      1140
     aaggcctgca acgaatggat cgccgactgg ttcgagcgca atcccagcga ggcgaaaacc      1200
     atcatcagca aggcggtttc ctcggcccag gcgcgggcgg ccgcccgcaa ggcgcgggac      1260
     ctggtccgcc ggaagggggc cctggaaatc ggcggcctgc cggggaagct ggccgactgc      1320
     cggtccaccg atccgagcaa gtccgagctg tacatcgtcg agggcgactc ggccggcggt      1380
     tcggccaagt cgggccggga ctcgatgttc caggcgatcc tgccgatccg cggcaagatc      1440
     atcaacgtgg agaaggcccg gatcgaccgg gtgctgcgca acaccgaggt gcagtccctg      1500
     atcaccgcgt tgggcacggg catccatgac gacttcgacc tggccaaact gcgctatcac      1560
     aagatcgtgc tgatggccga tgccgacgtc gacggccagc acatccgcac cctgctgctg      1620
     accctgctgt tccgcttcat gcggccgctg gtcgaggccg gccacgtcta cctggcccag      1680
     ccgcccctgt acaagatcaa gtggagcaag ggtgcgcacg agttcgccta ttccgaccgc      1740
     gagcgtgacg gcctgatcgc cgagggtgag cgggccgggc gccggatgat caaggacgag      1800
     ggtgtccagc ggtacaaggg tctgggcgag atgaacgcca aggagttgtg ggaaaccacc      1860
     atggacccgg ccaaccggtt gctgctccag gtgaccctgg aggacgcggc caccgcggac      1920
     gaactgttct cggtgctgat gggcgaggac gtcgaggcgc ggcgggcatt catcacccga      1980
     aacgccaagg acgtccggtt cctggatctg tga                                   2013
//

If you have problems or comments...

PBIL Back to PBIL home page