(data stored in ACNUC30630 zone)

EMBL: CP001737.PE70

CP001737.PE70        Location/Qualifiers
FT   CDS_pept        complement(79484..79771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0071"
FT                   /product="protein of unknown function UPF0233"
FT                   /note="PFAM: protein of unknown function UPF0233"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76508"
FT                   /db_xref="GOA:C8XIS1"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIS1"
FT                   /inference="protein motif:PFAM:PF06781"
FT                   /protein_id="ACV76508.1"
FT                   /translation="MPKSKVRKKVASSSASASAQANEAAAAAARAHVAAPSSPLYIGIM
FT                   LGLMVLGLVWLVVYYLWGASIPFISGLGNWNFAIGFTLMIAGLLMTMRWR"
     gtgcccaagt ccaaggttcg caagaaggtt gcgtccagtt ccgcgagtgc gtcggcccag        60
     gccaacgagg ccgctgcggc ggccgcgcgg gcgcacgtcg ccgccccgtc ctcgccgctg       120
     tacatcggga tcatgctcgg gctgatggtg ctcgggctgg tctggttggt cgtctactac       180
     ctctggggcg ccagcatccc gttcatctcg gggctgggga actggaactt cgcgatcggc       240
     ttcacgttga tgatcgccgg cctgctgatg acgatgcggt ggcgctga                    288
//

If you have problems or comments...

PBIL Back to PBIL home page