(data stored in ACNUC30630 zone)

EMBL: CP001737.PE72

CP001737.PE72        Location/Qualifiers
FT   CDS_pept        80678..81538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0073"
FT                   /product="peptidase C60 sortase A and B"
FT                   /note="PFAM: peptidase C60 sortase A and B; KEGG:
FT                   sde:Sde_0123 sortase (surface protein transpeptidase)-like"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76510"
FT                   /db_xref="GOA:C8XIS3"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042003"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIS3"
FT                   /inference="protein motif:PFAM:PF04203"
FT                   /protein_id="ACV76510.1"
FT                   /translation="MTAPRGPVTASGGRSVGRTLIRGAGEVLITLGVVVLLFVVYEVYI
FT                   TDLFGERKQAQATVAVDRVWADAEATATVVAQAPDQLATDPRERVPRYDTVTGEGFAKI
FT                   RIPVLGVDYVFTVVEGTDPDDLYIGPGHYPETQLPGEQGNFAVAGHRVSKGSPFNDLGL
FT                   LHSCDAIVVETQDDWFVYRVLPMAEEEATWASTPRARCGGVGVQAGAYAGVYGREITLP
FT                   SDYAQVLPVPTVLSTTVPPDAQRLITLTTCHPQFSDAERMIIHGVLVTSYAKAPGFLPP
FT                   ELAET"
     gtgaccgctc cgcgtgggcc ggtcaccgct tccggtgggc gcagcgtcgg gcgcacgctg        60
     atccgcgggg ccggcgaggt gctgatcacg ctgggcgtgg tcgtgctgtt gttcgtggtc       120
     tacgaggtct acatcaccga cctgttcggc gagcgcaagc aggcgcaggc caccgtcgcg       180
     gtggaccgcg tctgggcgga tgccgaggcg accgccacgg tcgtcgcgca ggcccccgac       240
     cagctggcga ccgacccgcg tgagcgggtt ccccggtacg acaccgtgac cggcgagggc       300
     tttgccaaga ttcggatccc ggtgctgggc gtcgattacg tgttcaccgt cgtcgagggc       360
     accgacccgg acgacctgta catcggcccc ggccactacc cggagaccca gctgcccggc       420
     gagcagggca acttcgcggt cgccgggcac cgcgtgtcca aggggtcgcc gttcaacgac       480
     ctgggcctgc tgcactcgtg cgacgcgatc gtggtggaga cccaggacga ctggttcgtc       540
     taccgggtgc tgccgatggc cgaggaggag gcgacctggg ccagcacgcc gcgggcccgc       600
     tgtggcgggg tcggggtgca ggccggggcc tacgccgggg tgtacggccg ggagatcacc       660
     ctgcccagcg actacgcgca ggtcctgccc gtcccgacgg tgctgtcgac cacggtgccg       720
     cccgacgcgc agcggttgat caccctgacc acctgccatc cgcagttctc cgacgccgag       780
     cggatgatca tccacggggt gctggtcacc agctacgcca aggcgcccgg tttcctgccg       840
     cccgaactcg ccgagacctg a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page