(data stored in ACNUC30630 zone)

EMBL: CP001737.PE76

CP001737.PE76        Location/Qualifiers
FT   CDS_pept        complement(86395..87543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0078"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: azo:azo3774 putative
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76514"
FT                   /db_xref="GOA:C8XIS7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIS7"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACV76514.1"
FT                   /translation="MTAPGVMLSQRYRLTRRIAVGGMGEVWAADDVRLARVVACKILRP
FT                   ELTGDPEFLGRFRTEARITASLNHPGICAVYDYGEVSGGNHYLTGTAYLVMELISGESL
FT                   SSVLNRLGRLSVGRTLDVLEQTGHALQQAHGQGLVHRDIKPGNLLITPGGQVKITDFGI
FT                   AKVAHEAPVTRSGMVMGTAQYISPEQAAGRDATPASDIYSLGVVAYECLSGRLPFQSDN
FT                   TVAIALAHVREAPPPLPEDVPAPIARLVMAMLAKDPAARFPNGEALARAAGQLRSGGPE
FT                   PRPPAPRPTLIAPIAPANAARPAAPRSPAPARPTRAAAPTMTPPAVRSAPPPQYRPPPT
FT                   PAPVSRSSGRRTGLSVLLAVLILLLAGLVLVVLNAVFGSMAM"
     atgacggcgc ccggggtgat gctctcgcag cgctaccgcc tgacccggcg gatcgcggtc        60
     ggcggcatgg gcgaggtgtg ggccgccgac gacgtgcggc ttgcccgggt ggtcgcctgc       120
     aagatcctgc ggcccgagct gaccggtgac cccgagttcc tgggccggtt ccgcaccgag       180
     gcgcggatca ccgcctcgct gaaccatccg gggatctgcg cggtctacga ctacggcgag       240
     gtctccggcg gcaaccacta cctgaccggc accgcctacc tggtgatgga gctgatcagc       300
     ggcgagtcgt tgtccagcgt gctgaaccgg ctcggccggc tgtccgtcgg tcgcaccctg       360
     gacgtgctgg agcagaccgg ccacgccctg cagcaggcgc acgggcaggg cctggtgcac       420
     cgcgacatca agccgggcaa cctgctgatc acccccggcg gccaggtcaa gatcaccgac       480
     ttcggcatcg ccaaggtcgc ccacgaggcc ccggtcaccc gctccggcat ggtcatgggc       540
     accgcccagt acatctcgcc ggagcaggcc gccggccggg acgccacgcc ggcctccgac       600
     atctattcgc tgggcgtggt cgcctacgag tgcctgtccg gccggctgcc gttccagagc       660
     gacaacaccg tcgcgatcgc gctggcccac gtccgcgagg cgccaccgcc gctgcccgag       720
     gacgtacccg cgccgatcgc ccgcctggtg atggcgatgc tggccaagga cccggcggct       780
     cgcttcccga acggtgaggc gctggcccgg gcggccggtc agctgcgcag cggcgggccc       840
     gagccacgcc cccccgcgcc gcggcccacc ctgatcgcgc cgatcgctcc ggccaacgcc       900
     gcccggccgg cggcgccgcg gtccccggcg ccggcccggc cgacccgcgc ggccgcgccg       960
     accatgaccc cgccggccgt tcggtcggca cctccgccgc agtaccgacc gccgcccacc      1020
     ccggccccgg tgagccgctc gtccgggcgc cgcaccggcc tgtccgtgct gctggcggtg      1080
     ctgatcctgc tgctggccgg actcgtgctg gtcgtcctca acgccgtctt cggctcgatg      1140
     gcgatgtga                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page