(data stored in ACNUC30630 zone)

EMBL: CP001737.PE83

CP001737.PE83        Location/Qualifiers
FT   CDS_pept        97344..98744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0087"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   transposase IS111A/IS1328/IS1533; KEGG: eba:ebA6749
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76521"
FT                   /db_xref="GOA:C8XI56"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C8XI56"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ACV76521.1"
FT                   /translation="MMTKQVEEILDEPHEQIVQRVCAIDVGKDSGTVCVRVPAASGTGR
FT                   RVSKVWDVPARTRAVLGLAAQLSDQGIEKVTLESTSDYWRIWFYLLEAHGLDVQLVNAR
FT                   DVKNVPGRPKTDKLDSVWLAKLTEKGLLRPSFVPSAQVRQLRDYTRMRADLTGDRTRYW
FT                   QRLEKLLEDALIKVTSVASRIDTLSVRDMIEALIAGQRDPRVLAGMARGRMRLKYADLV
FT                   ESLTGQFDDHHAELARMLLHQIDTLTDQIDVLTARIEALLASLPAGNTPDPDRPAPDGQ
FT                   TRPGTRANAPADEAAQRRTPPTAADMIKILDQIPGIGPSNAQVIIAEIGLDMSRFPTAG
FT                   HLVSWTRLCPRTIQSGKRSTTGKTGKGNRYLRAVLGEAAATGGKTQTFLGERYRRLIKR
FT                   RGKLKTIVAIARSILVIIWHLLANPGTTFHDLGVDFNDHRIDIGRRTRNHVRQLEALGF
FT                   NVTLTAAA"
     gtgatgacca aacaggtcga ggagatcctc gacgaacccc atgaacagat cgtgcagcgg        60
     gtctgcgcga tcgacgtggg caaggactcg ggcacagtct gcgttcgcgt accagccgcg       120
     tccgggacgg gtcggcgagt gagcaaagtc tgggacgtcc cggcccgaac cagagcggtc       180
     ctgggcctgg ccgcacagct gtcagaccag ggcatcgaga aggtgaccct ggaatcgact       240
     tcggactact ggcggatctg gttctatctg ctggaagctc atggcctgga cgtgcagttg       300
     gtcaatgccc gcgatgtcaa gaacgtcccc ggtcgcccca aaacggacaa gctggacagt       360
     gtgtggttgg ccaagctcac cgagaagggg ctgttgcgtc catcgttcgt gccatcagcg       420
     caggtccggc agttgcgcga ctacacccgg atgcgggccg atctgaccgg cgaccggacc       480
     aggtactggc aacggctgga gaagctgctg gaggacgccc tgatcaaggt cacctccgtg       540
     gcgagcagga tcgacaccct gtccgtccgg gacatgattg aggccctgat cgcgggccag       600
     cgggacccgc gggttctggc cggcatggcc cgcggccgga tgcggctcaa gtacgccgac       660
     ctggtcgagt cgctgaccgg tcagttcgac gatcatcacg ccgagctggc ccggatgctg       720
     ctgcatcaga tcgacacgct gaccgatcag atcgacgtcc tgaccgcacg catcgaggca       780
     ctcctggcca gcttgccggc cggtaacacc cccgatccgg accgccccgc accggatggc       840
     caaactcggc ccggtacgag ggctaacgca cccgccgacg aggcggccca gcgccggaca       900
     ccgccgacgg ccgcagacat gatcaagatc ctggaccaga tacccgggat cggcccaagc       960
     aacgcacagg tcatcatcgc cgagatcggg ctggacatga gccggttccc gaccgctggc      1020
     catctggtgt cctggacccg gctgtgcccc cgcacgatcc agtccgggaa acgatcaaca      1080
     accggtaaga ccggcaaggg caaccgttac ctgcgcgccg tgcttggtga agcggccgcg      1140
     accggcggca agacccaaac cttcctggga gaacgctatc gacgcctgat caaacgccgc      1200
     ggcaaactca aaacgatcgt cgccatcgcc cgatccatcc ttgtcatcat ctggcacctg      1260
     ctcgccaacc ccggcacgac cttccacgac ctcggcgtcg atttcaacga ccaccgcatc      1320
     gacatcggac gccgaacccg taaccacgtc cggcaactcg aagccctcgg cttcaacgtc      1380
     accctgaccg cggccgccta a                                                1401
//

If you have problems or comments...

PBIL Back to PBIL home page