(data stored in ACNUC30630 zone)

EMBL: CP001737.PE87

CP001737.PE87        Location/Qualifiers
FT   CDS_pept        complement(101840..102853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0091"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: azc:AZC_0020 initiation factor 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76525"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIT8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76525.1"
FT                   /translation="MHGDDKLPLGDLICPEPGCRAELVAVEVRKTGTRFLRNRPGTSDC
FT                   GHALGRAQSGGPPSAEHRWLQQRLAEMCGDLGHSAIQEHYESRADVWVHNTPPLAIEVQ
FT                   RWPTAFADRSRARQSTGANVLWLLPESASSQKAAKELFRQPAARVRVFEEGSRHVSATP
FT                   WNPGHSDRVWLSIGATVMRPSADGLTLVSAGNYDAKTFLREVLDGRRRWFGPREVGFKY
FT                   GSGWARPDEVEQMRAARARVKLRVPAPTLQAWPALVATDRLAVADQAPPTDTPPVAAAP
FT                   SIPGPEDFPSRPASGSADAVSQAELTHKVDPPTPSVMSGSTQRGWFRRFRTWLTGV"
     atgcacgggg acgacaaact tcccctgggc gacctgatct gcccggagcc gggttgtcgg        60
     gcggaactgg tcgcggtcga ggtgcggaag acaggaacac gcttcctccg gaatcggccg       120
     gggacatcgg actgcgggca tgccctcgga cgtgcgcaga gcggtgggcc tccttccgct       180
     gagcatcgct ggctgcagca gcgtctcgcc gaaatgtgtg gagacctcgg acactccgcg       240
     atccaggagc actacgagtc acgtgccgac gtctgggtcc acaacacgcc gccactggcg       300
     atcgaggttc aacgatggcc caccgcattc gccgaccgct cgcgggcccg ccaatccacc       360
     ggcgcaaacg tcctctggct cctaccggag agtgcgtcga gccagaaggc ggcaaaggag       420
     ctgtttcgcc agcccgccgc ccgtgtccgg gtctttgagg agggcagccg tcacgtttcg       480
     gccactccgt ggaatcctgg ccactccgat cgagtctggc tgtcgatcgg ggcgacggtg       540
     atgcgaccca gcgccgacgg cctcactctc gtgagcgccg gaaactacga cgccaagacc       600
     ttccttcgcg aggtgctcga cgggagacgg cgctggttcg gaccacgcga agtcggcttc       660
     aagtacggct ccggatgggc acgacctgac gaggtcgagc agatgcgggc ggcacgagcc       720
     agagtgaaac tccgcgttcc cgcgcccaca cttcaggcgt ggcccgctct tgtcgcgacc       780
     gatcgactag ccgttgccga ccaagcgcca ccgacggaca cgcccccggt cgcggccgct       840
     ccctcaatcc caggtcctga agatttccca agccgcccgg catccggctc ggcagacgcc       900
     gtttcccagg cggagttgac gcacaaggtc gacccgccca cgccgtcggt catgagcggc       960
     tcgacacaac gtggctggtt ccgccgattc cggacatggc ttacaggtgt gtag            1014
//

If you have problems or comments...

PBIL Back to PBIL home page