(data stored in ACNUC30630 zone)

EMBL: CP001737.PE94

CP001737.PE94        Location/Qualifiers
FT   CDS_pept        110212..111048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76532"
FT                   /db_xref="InterPro:IPR024498"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIU5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76532.1"
FT                   /translation="MSEKDLARIAALLRKAEGTDNDHEADAFLQAAQRLATLASVDLAM
FT                   ARSHTQRQERRPVPTQRAIVIGESGKRGLRTYVELFLAIGRANNLTCDIARDSTRVHAF
FT                   GFDTDIDMAQTLYASLVVQMVRASDAYIKSGDYAVEKVIKRVAVTTPGRSGGWRQEYQY
FT                   VEKPVHATTARINFQQAFAHRIAARLAQARQETEQQLIAEQPDEQGRGVALVLRNREVE
FT                   LADHYRAHSQARGTWSGTRAAAGQAERSRRAGDRAGRRARLTPEKAIGGQRGAIDG"
     ttgagcgaga aggacctggc ccggatcgcc gcgctgctgc gcaaggccga ggggaccgac        60
     aacgaccacg aggcggacgc ctttctgcag gcggcgcagc ggctggccac gctggcctcg       120
     gtcgacctgg cgatggcccg ctcgcatacc cagcggcagg aacggcggcc ggtcccgacc       180
     cagcgggcca tcgtgatcgg tgagtccggc aagcgcgggc tgcgcaccta cgtcgagctg       240
     ttcctggcca tcggccgggc caacaacctg acctgcgaca tcgcccgcga ttcgacccgg       300
     gtgcatgcgt tcggcttcga caccgacatc gacatggcgc agaccctgta cgcctcgctg       360
     gtggtgcaga tggtccgggc ctccgacgcg tacatcaagt ccggtgacta cgccgtggag       420
     aaggtgatca aacgggtcgc ggtgacgacc cccggccggt ccggcgggtg gcggcaggag       480
     taccagtacg tggagaagcc ggtgcacgcc accaccgcgc ggatcaactt ccaacaggcc       540
     ttcgcgcacc gcatcgccgc ccgcctggcc caggcgcggc aggagaccga acagcagctg       600
     atcgccgagc agccggacga gcagggtcgt ggggtggcgt tggtcctgcg caaccgcgag       660
     gtcgaactgg ccgatcacta ccgggcccac tcgcaggccc gcggcacctg gtccggcacc       720
     cgcgcggcgg ccggccaggc cgaacgctcc cgccgggccg gtgatcgggc cgggcggcgg       780
     gcgcggctga ccccggagaa ggcgatcggt gggcagcgtg gggcgatcga cggctga          837
//

If you have problems or comments...

PBIL Back to PBIL home page