(data stored in ACNUC30630 zone)

EMBL: CP001737.PE95

CP001737.PE95        Location/Qualifiers
FT   CDS_pept        111020..111550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76533"
FT                   /db_xref="InterPro:IPR027595"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIU6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76533.1"
FT                   /translation="MGSVGRSTAETAPRDGQRAKVYEAEHLVHRIFDRSAEYPVVQIAG
FT                   SQLVLPPERRFGSVPAVQVYVRRVLDLGWVRATWPRATVPVRVRERAGSTQAHYERAGA
FT                   VMAVPGYRTGSGWALRELVILHELAHHLADQVEPAHGGPFVDRLLTLVDGVIGAEAALL
FT                   MRITMLDAGVAIG"
     gtgggcagcg tggggcgatc gacggctgag acggcgcccc gcgacggcca gcgggccaag        60
     gtctacgagg ccgagcatct ggtgcaccgg atcttcgacc ggtccgccga gtacccggtg       120
     gtgcagatcg ccgggtcgca gctggtgcta ccgccggaac ggcgtttcgg ctcggtgccg       180
     gccgtgcagg tttacgtccg ccgggtgctc gacctgggct gggtgcgcgc cacctggccg       240
     cgggcgacgg tgccggtccg ggtgcgcgag cgggccggct ccacccaggc gcactacgaa       300
     cgggccgggg cggtcatggc cgtgccgggg taccggaccg ggtcggggtg ggccctgcgg       360
     gagctggtga tcctgcacga gctcgcgcat cacctggccg atcaggtcga accggcgcac       420
     ggcgggccgt tcgtggatcg gctgctcacc ctggtcgacg gggtgatcgg ggccgaggcg       480
     gcgctgctga tgcggatcac catgctggac gccggggtgg ccatcggctg a                531
//

If you have problems or comments...

PBIL Back to PBIL home page