(data stored in ACNUC30630 zone)

EMBL: CP001737.PE98

CP001737.PE98        Location/Qualifiers
FT   CDS_pept        complement(112786..112971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76536"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIU9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76536.1"
FT                   /translation="MVRRFTTIRWVDVTMVFQPAPGDPIRIRRSDGKLFVLPGVGLDRL
FT                   PEILALATQDSAEPRA"
     gtggtccggc ggttcaccac catccgctgg gtcgatgtga ccatggtctt ccagccggct        60
     ccgggggatc cgatccggat ccggcgaagc gacggcaagc tgttcgtcct gcccggggtg       120
     ggcctcgacc ggctcccgga gatcctcgcc ctggccacgc aggactctgc cgaacccagg       180
     gcctga                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page