(data stored in ACNUC30630 zone)

EMBL: CP001738.PE103

CP001738.PE103       Location/Qualifiers
FT   CDS_pept        complement(109118..109822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0104"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: hch:HCH_02036 amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95712"
FT                   /db_xref="GOA:D1ADK2"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADK2"
FT                   /inference="protein motif:PFAM:PF00795"
FT                   /protein_id="ACY95712.1"
FT                   /translation="MRKPLSIAVAQPPCVSYDVAANAATHADVVRSAGARVVVFPEMSL
FT                   TGYELDAPAITAGDPRLAPLVRACARTGTVALAGAPVRGESGAAHIAILAFEGTGARVA
FT                   YRKMWLGAAEAERFAPGGEPAVLEVDGRRLGLAICKDTGIVRHSADTAALGMDVYVAGV
FT                   LEHAKDAAVRDERARRIAADHRVWVAVASFAGSTGGGFTRAAGGSGIWAPGGAVLAQAG
FT                   TEAGAVVRAVLE"
     atgcgcaagc cgctcagcat cgccgtggcc cagccgccgt gcgtctccta cgacgtcgcg        60
     gcgaacgcgg cgacgcatgc ggacgtggtg cgttccgcgg gcgcgcgggt ggtggtcttc       120
     cccgagatgt ccctgacggg gtacgagctg gacgccccgg cgatcacggc cggcgatccg       180
     cggctggcgc cgctggtgcg ggcgtgcgcc cggaccggga cggtggcgct ggcgggcgcc       240
     ccggtgcgcg gcgagtcggg cgcggcgcac atcgcgatcc tggccttcga gggcaccggc       300
     gcgcgcgtgg cctaccgcaa gatgtggctg ggcgccgccg aggccgagcg gttcgccccg       360
     ggcggcgagc cggccgtgct ggaggtcgat ggacgccggc tgggcctggc gatctgcaag       420
     gacaccggca tcgtccggca ctccgccgac accgcggcgc tgggcatgga cgtgtatgtc       480
     gccggggtgc tggagcacgc taaggacgcc gccgtccggg acgagcgcgc ccgccgcatc       540
     gccgccgatc accgggtctg ggtcgcggtg gccagtttcg ccggctccac cggcggcggc       600
     ttcacccgtg ccgccggggg ctcgggcatc tgggcgcccg gcggagccgt gctcgcccag       660
     gcgggcaccg aggccggcgc cgtcgtccgc gccgtgctcg agtga                       705
//

If you have problems or comments...

PBIL Back to PBIL home page