(data stored in ACNUC30630 zone)

EMBL: CP001738.PE105

CP001738.PE105       Location/Qualifiers
FT   CDS_pept        111433..112116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0106"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ank:AnaeK_2686
FT                   regulatory protein TetR"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95714"
FT                   /db_xref="GOA:D1ADK4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADK4"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACY95714.1"
FT                   /translation="MEPTLSFLMTTSGDESLIERAYTDAVEQNDDMDETSARILDAAYE
FT                   QFCRMGIQRSTMEDVARRAGVSRITVYRRFATKDALVEQVVRREFRRYFDQFLIDIQQA
FT                   ETAADRVVLGFVSSLRAIRRNPLIGGLIETEPDLVVPSMISDGGRTLAVVRQFVAGQLR
FT                   REQQAGNVSPDLDTDLVAEMMVRISASFLGIPSFIVDLDDEEQLADIARRFLVPMLQPP
FT                   APRES"
     gtggagccta cgttgtcctt cctcatgacg acctcggggg acgagtcgct gatcgagcgc        60
     gcctacaccg atgccgtcga acagaacgac gacatggacg agaccagcgc gcgcattctc       120
     gacgccgcct acgagcagtt ctgccggatg ggcatccagc ggtccaccat ggaggacgtg       180
     gcccggcggg ccggggtctc gcggatcacc gtctaccggc gtttcgccac caaggacgcg       240
     ctggtcgaac aggtggtgcg ccgggagttc cgccgctact tcgaccagtt cctcatcgac       300
     atccagcagg ccgagaccgc cgccgaccgg gtggtgctgg gctttgtcag ctcgctgcgc       360
     gccatccggc gcaacccgct gatcggcggg ctgatcgaga ccgagccgga cctggtggtg       420
     ccctccatga tcagcgacgg cgggcggacg ctggccgtgg tgcggcagtt cgtcgccggc       480
     cagctgcgcc gcgaacagca ggccggcaac gtctcaccgg acctggacac cgacctggtg       540
     gccgagatga tggtccgcat ctccgcctcg ttcctgggca tccccagctt catcgtcgac       600
     ctggacgacg aagagcagct ggccgacatc gcccggcggt tcctggtgcc gatgctgcag       660
     ccgccggccc cccgcgagag ctga                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page