(data stored in ACNUC30630 zone)

EMBL: CP001738.PE110

CP001738.PE110       Location/Qualifiers
FT   CDS_pept        complement(116918..118036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0111"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: scl:sce5432 putative two-component system
FT                   sensor kinase; PFAM: histidine kinase dimerisation and
FT                   phosphoacceptor region; ATP-binding region ATPase domain
FT                   protein; SMART: ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95719"
FT                   /db_xref="GOA:D1AEA3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEA3"
FT                   /inference="protein motif:PRIAM:2.7.13.3"
FT                   /protein_id="ACY95719.1"
FT                   /translation="MRLPQGRAADAAIAGGMFALMAVAGLRAFIGERLEPWPVTVAGWA
FT                   LTAAACGALYLRRRRPVAVAVFVLAVTIAYYLGSAYDGPLLVVFIVALYTVAAEGRLQA
FT                   AVALAALALICVGAGTLAGNDEVNGIALFMLAGWLVAVVALGQVRHGRLAYLQEVQRRA
FT                   AGEERLRIARELHDVVGHHLSLINVQSAAALHRIGKDPAQAKAALGAIKESSRTALRDL
FT                   RATLGVLRESGEQAPTAPAPGLARLEELIESARLAGLQVHAETGGEQRPLPTEVDLAAY
FT                   RIVQEALTNVTRHARAGAVTVRLDHGPGELTVEVTDDGRGPVPPAGPPGSGISGMRERA
FT                   RALGGELVAGPRPGGGFTVRARLPYRNGASAR"
     gtgcggctgc cgcaggggcg cgcggcggac gcggcgatcg ccggtgggat gttcgcgctg        60
     atggccgtcg ccgggctcag ggcgttcatc ggcgagcgcc tggagccgtg gccggtcacc       120
     gtcgcgggct gggcgctgac ggccgccgcc tgcggggcgc tgtacctgcg gcgccggcgt       180
     ccggtggccg tcgccgtctt cgtgctggcc gtcaccatcg cctactacct cggcagcgcc       240
     tacgacgggc cgctgctggt ggtgttcatc gtcgcgctgt acaccgtcgc ggccgaggga       300
     cgcctgcagg cggccgtcgc gctggccgcg ctggcgctga tctgcgtggg cgccgggacg       360
     ctggccggca acgacgaggt caacggcatc gccctgttca tgctggccgg ctggctggtg       420
     gcggtggtgg cgctcgggca ggtccgccac ggccgcctgg cctacctgca ggaggtgcag       480
     cggcgggccg ccggggagga gcggctgcgc atcgcccggg aactgcacga cgtggtcggc       540
     caccacctgt cgctcatcaa cgtccagtcg gcggcggcgc tgcaccgcat cggcaaggac       600
     ccggcacagg ccaaggccgc cctcggcgcg atcaaggagt ccagccggac ggcgctgcgg       660
     gacctgcgcg ccaccttggg ggtgctgcgg gaaagcggcg aacaggcgcc caccgcgccc       720
     gccccggggc tggcgcggct ggaggagctg atcgagtcgg cgcggctggc cgggctgcag       780
     gtgcacgccg agaccggcgg cgagcagcgc ccgctgccca ccgaggtgga tctggccgcc       840
     taccgcatcg tccaggaggc gctgaccaac gtgacccggc acgcccgcgc cggcgcggtc       900
     accgtccggc tcgaccacgg gccgggggag ctgacggtgg aggtcaccga cgacggccgc       960
     ggacccgtcc cgccggccgg cccgcccggc agcggcatca gcggcatgcg ggaacgcgcc      1020
     cgggcgctgg gcggggagct ggtcgccggg ccccgtccgg gcggcgggtt caccgtccgg      1080
     gcccgcctgc cctaccggaa cggggcgtct gcgcggtga                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page