(data stored in ACNUC30630 zone)

EMBL: CP001738.PE113

CP001738.PE113       Location/Qualifiers
FT   CDS_pept        complement(120924..121310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95722"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEA6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95722.1"
FT                   /translation="MHVHQRLGHTGGDPHLVRLRERLEAIRTRSEKSTSWHSAGRYLSR
FT                   LVNREGYVPVNTHISREDLEFLTGARDEVIALTDLALRLLELHQPRDAGGISSDPTHLS
FT                   RRCRACMWRWPCPTFRIIDESAPR"
     gtgcacgtgc atcagcggct tggtcatacc gggggcgacc cgcacctggt gcgccttcgg        60
     gaacgtttgg aggcgatccg aacccgctcg gagaagtcca cctcgtggca ctcggcgggc       120
     cgttacctgt cacgcctggt caaccgggag ggctacgtcc cggtcaatac ccatatcagc       180
     cgagaggacc tggagtttct gaccggtgcg cgcgacgagg tgatcgccct caccgacctg       240
     gcgctgcggc tgctggagct tcaccagccc cgggacgccg gcggcatctc cagcgacccc       300
     acccacctca gccggcgctg ccgggcctgc atgtggcgct ggccctgccc gaccttccgc       360
     atcatcgacg agtccgctcc ccgctga                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page