(data stored in ACNUC30630 zone)

EMBL: CP001738.PE122

CP001738.PE122       Location/Qualifiers
FT   CDS_pept        132794..133255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0124"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gme:Gmet_2888 polysaccharide biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95731"
FT                   /db_xref="GOA:D1AEB5"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEB5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95731.1"
FT                   /translation="MERQEFTQGALPSPQEARAALEAVEQARESVKTTQWPMWYFVALG
FT                   VWVAPLGLLSRMPTDFPRVLVALVALMAWMGLFSAIVALGARKTGVVPSFSREQVVHIA
FT                   AILVPVAVIAALIGWKAGTDWALPSFSALEGAMIVLYALWVRHRSARSA"
     atggaaaggc aagagttcac gcagggggcg ctgccctctc cgcaggaggc ccgggccgcg        60
     ctggaggcgg tggagcaggc tcgggagtcg gtgaagacca cccagtggcc gatgtggtac       120
     ttcgtcgccc tcggggtgtg ggtggccccg ctcgggctgc tgtcgcggat gccgaccgac       180
     ttcccccggg tgctggtggc gctggtggcg ctgatggcgt ggatggggct gttcagcgcc       240
     atcgtcgcgc tcggcgccag gaagaccggt gtggtgccct ccttctcccg cgagcaggtg       300
     gtgcacatcg ccgcgatcct ggtgccggtc gccgtcatcg ccgcgctgat cggctggaag       360
     gccgggacgg actgggcgct gccgtccttc agcgcgctgg agggagccat gatcgtcctg       420
     tacgccctgt gggtgcggca ccggagcgct cggtcggcat ga                          462
//

If you have problems or comments...

PBIL Back to PBIL home page