(data stored in ACNUC30630 zone)

EMBL: CP001738.PE124

CP001738.PE124       Location/Qualifiers
FT   CDS_pept        134013..134870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0126"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase type 3; Haloacid dehalogenase
FT                   domain protein hydrolase; KEGG: scl:sce2325 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95733"
FT                   /db_xref="GOA:D1AEB7"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEB7"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ACY95733.1"
FT                   /translation="MYAGAGEDGLAERKAPPRLVATDLDGTLVRSDGTISARTVQALAR
FT                   VERAGSTLVMVTGRPPRWMRDAAAAVDHRGIAICANGAVLYDLHTETVLRTRLIEAEVV
FT                   DEVVRRLREAAPEFRFAVEYTDGFVYEASYDLGRWDLEALGGRPVGERELVSRGGIKLL
FT                   AFHPGADPDRLAEETRKAVGDLVTVTHSSGRGLMEMSAHGVTKASALAELCAERGVAAA
FT                   DVVAFGDMPNDLPMLTWAGTSYGVANGHPDVLSAVTHTIGRNDDDGVAKVLEQLFPATG
FT                   ADVR"
     gtgtacgcag gagcggggga ggacggcttg gctgagcgga aggcaccgcc ccggctggtc        60
     gccaccgatc tggacggcac cctcgtgcgc tccgacggca ccatctccgc gcgcaccgtc       120
     caggcgctgg cccgggtgga acgcgccggc tccacgctgg tcatggtcac cggacggccg       180
     ccgcggtgga tgcgggacgc cgccgccgcc gtcgaccacc gcggcatcgc catctgcgcc       240
     aacggggcgg tgctgtacga cctgcacacc gagaccgtgc tgcgcacccg cctgatcgag       300
     gccgaggtgg tcgacgaggt ggtgcggcgg ctgcgcgagg ccgccccgga gttccgcttc       360
     gccgtcgagt acaccgacgg gttcgtctat gaggccagct acgacctcgg ccgctgggac       420
     ctcgaggcgc tgggcggccg tccggtgggc gaacgggaac tggtcagccg gggcggcatc       480
     aaactgctgg ccttccaccc cggcgccgac cccgaccggc tggccgagga gacccgcaag       540
     gccgtggggg acctggtcac cgtgacccac tcctccggcc gggggctgat ggagatgagc       600
     gcccacggcg tcaccaaggc cagcgccctg gcggagctgt gcgccgagcg gggggtggcc       660
     gccgccgacg tggtcgcctt cggtgacatg cccaacgacc tgccgatgct cacctgggcc       720
     ggcacttcct acggcgtcgc caacggccac cccgacgtgc tgtcggcggt cacccacacc       780
     atcgggcgca acgacgacga cggcgtcgcc aaggtcctgg agcagctctt ccccgccacc       840
     ggcgccgacg ttcgatga                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page