(data stored in ACNUC30630 zone)

EMBL: CP001738.PE125

CP001738.PE125       Location/Qualifiers
FT   CDS_pept        complement(135043..135606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95734"
FT                   /db_xref="GOA:D1AEB8"
FT                   /db_xref="InterPro:IPR019695"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEB8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95734.1"
FT                   /translation="MNEPRSNASEQNPQVLVVGPNGIAVEGGSNDSGEEERPVTEMVEQ
FT                   PAKVMRIGGMIRQLLEEVKSAPLDEASRARLKEIHASSIKEIKEGLAPELVEELERLSL
FT                   PFAEEEVPSEAELRIAQAQLVGWLEGLFHGIQTTLFAQQMAARAQLEQMRRALPAGALS
FT                   SGAAQSRGDEEHKHRSGHASGPYL"
     atgaacgagc cccgaagcaa cgcatcagag cagaatcccc aggttctcgt ggtcgggccg        60
     aacggcatcg cggtggaggg gggttccaac gactccgggg aggaagagcg ccccgtcacc       120
     gagatggtcg agcagcccgc caaggtgatg cggatcggcg ggatgatccg gcagctcctg       180
     gaggaggtca agtcggcgcc gctggatgag gccagccggg ccaggctcaa ggagatccac       240
     gcctcctcga tcaaggagat caaggaaggg ctcgcccccg agctggtgga ggagctggag       300
     cggctgtcgc tgccgttcgc cgaggaggag gtccccagcg aggccgagct gcgcatcgcc       360
     caggcccagc tggtgggctg gctggagggc ctgttccacg ggatccagac caccttgttc       420
     gcccagcaga tggccgcccg cgcccagctg gagcagatgc ggcgcgcgct gccggccggc       480
     gccctgtcct ccggcgcggc ccagtcccgc ggcgacgagg agcacaagca ccgctccggt       540
     cacgcctccg gcccctacct gtga                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page